y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G382557_T01
FamilyCE8
Protein PropertiesLength: 408 Molecular Weight: 43968.3 Isoelectric Point: 8.7713
ChromosomeChromosome/Scaffold: 1 Start: 148513254 End: 148515654
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8983930
  YVVSPDGKGKFRTINEAVRAVPEGNKRRVILDIRTATYREKVLVPYTKPFITFLGNPKNPPVIMWDDRAATHGKDGKPVGTVGSATVAVESDYFMASGIV
  FRNHAPMAAPGQEGGQAVALRVFGTKAAFYDCTIEGGQDTLYDHKGLHYFKSCHIQGSVDFIFGFGRSLYEDCAIMSVTKQVAVVTAQQRTKSIAGAIES
  GFSFLRCRIAGTGAGQIYLGRAWGDSSRVVYSYTTMGKEVVPVGWDGWRIERPEKSGIYYGEYMCSGPGALPHKRIGWSLVLNDAQAKPFTGIHFI
Full Sequence
Protein Sequence     Length: 408     Download
MGHQNCRRPP HVVVALVAIV LLQPCFVSVA SSSSSVAIDG GGTNVKVPAV DGGAGSFVEF    60
VTENVELYSN VSNEHMYGSA GKVWDPQLLV AQGMVVRYVV SPDGKGKFRT INEAVRAVPE    120
GNKRRVILDI RTATYREKVL VPYTKPFITF LGNPKNPPVI MWDDRAATHG KDGKPVGTVG    180
SATVAVESDY FMASGIVFRN HAPMAAPGQE GGQAVALRVF GTKAAFYDCT IEGGQDTLYD    240
HKGLHYFKSC HIQGSVDFIF GFGRSLYEDC AIMSVTKQVA VVTAQQRTKS IAGAIESGFS    300
FLRCRIAGTG AGQIYLGRAW GDSSRVVYSY TTMGKEVVPV GWDGWRIERP EKSGIYYGEY    360
MCSGPGALPH KRIGWSLVLN DAQAKPFTGI HFIFGDSWIL PPPSLVG*                 420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02304PLN023049.0e-82100401312+
PLN02634PLN026343.0e-8599401303+
PLN02671PLN026712.0e-9099399304+
PLN02682PLN026825.0e-106104401298+
PLN02665PLN026658.0e-11385405322+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABA95297.204440262426Pectinesterase family protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankACF22736.105740431381pectinesterase family protein [Brachypodium distachyon]
GenBankEEC69509.105640369412hypothetical protein OsI_38743 [Oryza sativa Indica Group]
RefSeqNP_001067039.105640368411Os12g0563700 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002443368.1014051431hypothetical protein SORBIDRAFT_08g018360 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A09939910308A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A9e-39943991304B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_B2e-1910127412192B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_A2e-1910127412192B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntp_B2e-1910127412192B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Transmembrane Domains
StartEnd
1234
Signal Peptide
Cleavage Site
32
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR82975127412740
EB16608426012600
DR80356022812280
DY5367752092004080
EB7024441922174080