y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G386824_T03
FamilyGH35
Protein PropertiesLength: 823 Molecular Weight: 92710.4 Isoelectric Point: 6.69
ChromosomeChromosome/Scaffold: 7 Start: 175743360 End: 175751817
Descriptionbeta-galactosidase 11
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35433460
  LMIDGKRDLFFSGAIHYPRSPPEVWPKLIERAKEGGLNTIETYIFWNAHEPEPGKYNFEGRFDLIKYLKMIQEHDMYAIVRIGPFIQAEWNHGGLPYWLR
  EIDHIIFRANNDPYKKEMEKFVRFIVQKLKDAELFASQGGPIILTQIENEYGNIKKDHATDGDKYLEWAAQMALSTQTGVPWIMCKQSSAPGEVIPTCNG
  RHCGDTWTLRDKNKPMLWTENWTQQFRAYGDQVAMRSAEDIAYAVLRFFAKGGSLVNYYMYHGGTNFGRTGASYVLTGYYDEAPMDEYGMYKEPKFGHLR
  DLHN
Full Sequence
Protein Sequence     Length: 823     Download
MTVRAAAVLV AAAVLVLLLP GWAAAEWNLT KKGSVVTYDG RSLMIDGKRD LFFSGAIHYP    60
RSPPEVWPKL IERAKEGGLN TIETYIFWNA HEPEPGKYNF EGRFDLIKYL KMIQEHDMYA    120
IVRIGPFIQA EWNHGGLPYW LREIDHIIFR ANNDPYKKEM EKFVRFIVQK LKDAELFASQ    180
GGPIILTQIE NEYGNIKKDH ATDGDKYLEW AAQMALSTQT GVPWIMCKQS SAPGEVIPTC    240
NGRHCGDTWT LRDKNKPMLW TENWTQQFRA YGDQVAMRSA EDIAYAVLRF FAKGGSLVNY    300
YMYHGGTNFG RTGASYVLTG YYDEAPMDEY GMYKEPKFGH LRDLHNVIRS YQKAFLLGKH    360
SSEILGHGYE AHIFELPEEN LCLSFLSNNN TGEDGTVIFR GEKHYVPSRS VSILAGCKNV    420
VYNTKRVFVQ HNERSYHTSE VTSKNNQWEM YSEKIPKYRD TKVRMKEPLE QFNQTKDASD    480
YLWYTTSFRL ESDDLPFRND IRPVLQVKSS AHSMMGFAND AFVGCARGSK QVKGFMFEKP    540
VDLKVGVNHV VLLSSTMGMK DSGGELAEVK SGIQECLIQG LNTGTLDLQV NGWGHKAALE    600
GEDKEIYSEK GVGKVQWKPA ENGRAATWYK RYFDEPDGDD PVVLDMSSMD KGMIFVNGEG    660
VGRYWVSYRT LAGTPSQALY HIPRPFLKSK DNLLVVFEEE MGKPDGILVQ TVTRDDICLF    720
ISEHNPGQIK TWDTDGDKIK LIAEDHSRRG TLMCPPEKTI QEVVFASFGN PEGMCGNFTE    780
CLGKPSCMLP VDHTVYGADI NCQSTTATLG VQVRCGGGKK GA*                      840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02140Gal_Lectin1.0e-775481580+
pfam02449Glyco_hydro_424.0e-863194146+
COG1874LacA3.0e-2236213185+
pfam01301Glyco_hydro_356.0e-13642348322+
PLN03059PLN03059036815823+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAG30724.102581524825putative beta-galactosidase precursor [Hordeum vulgare]
EMBLCAG30731.102681528832beta-galactosidase precursor [Triticum monococcum]
GenBankEEE70132.102681526830hypothetical protein OsJ_30164 [Oryza sativa Japonica Group]
Swiss-ProtQ0IZZ802681326828BGL12_ORYSJ RecName: Full=Beta-galactosidase 12; Short=Lactase 12; Flags: Precursor
RefSeqXP_002460584.102982229803hypothetical protein SORBIDRAFT_02g031260 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A9.99967e-424234414325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3d3a_A0.008616698497572A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D2e-38283543337A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C2e-38283543337A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Transmembrane Domains
StartEnd
524
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160703367130
DT9423822762415160
DN2295212424566970
HO780602591866680
HO780602396656990.31