| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G389582_T01 |
| Family | GH19 |
| Protein Properties | Length: 163 Molecular Weight: 17582.6 Isoelectric Point: 4.8184 |
| Chromosome | Chromosome/Scaffold: 5 Start: 63277951 End: 63280101 |
| Description | basic chitinase |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH19 | 6 | 142 | 0 |
| AQWPCVAGKKYFGRGPIQLSYNYNYGPAGEDATIAQDLLSNPELVASDAVISFKTAIWFWMTAQPPKPSCHDVATEQWTPSAADKAAGRLPGYGVITNII NGIECGKGYNEKVANRTFFYTSYCDILGISYGDNLDC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 163 Download |
| MTGEYAQWPC VAGKKYFGRG PIQLSYNYNY GPAGEDATIA QDLLSNPELV ASDAVISFKT 60 AIWFWMTAQP PKPSCHDVAT EQWTPSAADK AAGRLPGYGV ITNIINGIEC GKGYNEKVAN 120 RTFFYTSYCD ILGISYGDNL DCYNQRPFNS ASLAGTAAHA EA* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG3179 | COG3179 | 0.002 | 13 | 68 | 56 | + Predicted chitinase [General function prediction only] | ||
| cd00442 | lysozyme_like | 4.0e-12 | 5 | 105 | 101 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. | ||
| pfam00182 | Glyco_hydro_19 | 6.0e-80 | 6 | 142 | 138 | + Chitinase class I. | ||
| cd00325 | chitinase_glyco_hydro_19 | 8.0e-81 | 5 | 142 | 139 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004568 | chitinase activity |
| GO:0006032 | chitin catabolic process |
| GO:0016998 | cell wall macromolecule catabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAA51377.1 | 0 | 6 | 154 | 184 | 331 | chitinase [Oryza sativa Indica Group] |
| GenBank | AAA62420.1 | 0 | 1 | 147 | 116 | 261 | class I acidic chitinase [Zea mays] |
| GenBank | AAL05885.1 | 0 | 6 | 148 | 87 | 228 | AF416677_1 endochitinase [Musa acuminata AAA Group] |
| EMBL | CAC81811.1 | 0 | 6 | 156 | 168 | 317 | putative chitinase [Musa acuminata] |
| GenBank | EEE63651.1 | 0 | 6 | 154 | 144 | 291 | hypothetical protein OsJ_18468 [Oryza sativa Japonica Group] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1cns_B | 0 | 6 | 148 | 101 | 242 | A Chain A, Crystal Structure Of Chitinase At 1.91a Resolution |
| PDB | 1cns_A | 0 | 6 | 148 | 101 | 242 | A Chain A, Crystal Structure Of Chitinase At 1.91a Resolution |
| PDB | 2baa_A | 0 | 6 | 148 | 101 | 242 | A Chain A, The Refined Crystal Structure Of An Endochitinase From Hordeum Vulgare L. Seeds To 1.8 Angstroms Resolution |
| PDB | 4dyg_B | 0 | 6 | 148 | 102 | 243 | A Chain A, The Refined Crystal Structure Of An Endochitinase From Hordeum Vulgare L. Seeds To 1.8 Angstroms Resolution |
| PDB | 4dyg_A | 0 | 6 | 148 | 102 | 243 | A Chain A, The Refined Crystal Structure Of An Endochitinase From Hordeum Vulgare L. Seeds To 1.8 Angstroms Resolution |
| Hydropathy |
|---|
 |