CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G404767_T01
FamilyCE8
Protein PropertiesLength: 326 Molecular Weight: 35772.8 Isoelectric Point: 7.8469
ChromosomeChromosome/Scaffold: 5 Start: 175635989 End: 175639304
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82193199.3e-29
  GCSLYTRRPAPGQKNVVTAQGREDPNQSTSIVVQGGKVATAADLAPLVANISSYLGRPWKRYSRAVFAQTKMEALVHPRGWLEWNATFALDTLYYAEYMN
  R
Full Sequence
Protein Sequence     Length: 326     Download
MPGFTVAQAL EASTGGDTVT LPPFDISAPP PYHRRFVEAP RPCLLHQRFG EAMPPSVAPP    60
LSSSPPPASS PSTVSTSVRG LATKVEVVEI DLTEEDTSSL AHAPRRRPWT GREERRSIHP    120
VVGCNENLGL LEPGVFVANL RLRYGFRQLD REEGVLALLE LKVRVEADPH GIQDWDPADA    180
AGLAYGALTL TFVIIDEWDV NSICRRFTLH TRIYLGSKGC SLYTRRPAPG QKNVVTAQGR    240
EDPNQSTSIV VQGGKVATAA DLAPLVANIS SYLGRPWKRY SRAVFAQTKM EALVHPRGWL    300
EWNATFALDT LYYAEYMNRV CCKPI* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02201PLN022015.0e-3622031899+
PLN02301PLN023012.0e-36220319100+
PLN02713PLN027133.0e-38218318101+
PLN02484PLN024842.0e-39218318101+
pfam01095Pectinesterase2.0e-50219319101+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF35897.12e-36218319125226AF229849_1 pectin methylesterase isoform alpha [Vigna radiata]
GenBankACQ85264.14e-37218319413514pectin methylesterase [Musa acuminata AAA Group]
GenBankEEC82670.11.4013e-45218319427528hypothetical protein OsI_27314 [Oryza sativa Indica Group]
RefSeqNP_001060620.11.4013e-45218319427528Os07g0675100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002463382.10218319447548hypothetical protein SORBIDRAFT_02g042780 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A4e-33220318170268A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A4e-28220319166265B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA1870331022183190
CA1935961022183190
FE6517991022183190
FE6518001022183190
HO1340631022183190