Basic Information | |
---|---|
Species | Zea mays |
Cazyme ID | GRMZM2G405581_T01 |
Family | AA2 |
Protein Properties | Length: 152 Molecular Weight: 15259.5 Isoelectric Point: 6.4652 |
Chromosome | Chromosome/Scaffold: 5 Start: 145508963 End: 145510366 |
Description | Peroxidase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 39 | 137 | 3.4e-25 |
HSIVRQAMSQAVTNNTRSAAAVLRVFFHDCFVNGCDASLLLDDTPTTPGEKGAGPNAGGSTVGFDLIDTIKAQVEAACPATVSCADILALTARDGVNLV |
Full Sequence |
---|
Protein Sequence Length: 152 Download |
MARRLLAAVA IVVVAAALAC GAGAQLSAGF YSSSCPAVHS IVRQAMSQAV TNNTRSAAAV 60 LRVFFHDCFV NGCDASLLLD DTPTTPGEKG AGPNAGGSTV GFDLIDTIKA QVEAACPATV 120 SCADILALTA RDGVNLVSVR SVPCFSPQSM T* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00314 | plant_peroxidase_like | 0.0004 | 40 | 128 | 97 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN03030 | PLN03030 | 6.0e-31 | 30 | 138 | 109 | + cationic peroxidase; Provisional | ||
pfam00141 | peroxidase | 2.0e-34 | 42 | 134 | 93 | + Peroxidase. | ||
cd00693 | secretory_peroxidase | 2.0e-57 | 30 | 137 | 108 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAH69268.1 | 0 | 22 | 131 | 28 | 137 | TPA: class III peroxidase 26 precursor [Oryza sativa (japonica cultivar-group)] |
GenBank | EAY85141.1 | 0 | 22 | 137 | 28 | 143 | hypothetical protein OsI_06496 [Oryza sativa Indica Group] |
GenBank | EAZ22364.1 | 0 | 22 | 136 | 28 | 142 | hypothetical protein OsJ_06022 [Oryza sativa Japonica Group] |
RefSeq | NP_001046393.1 | 0 | 22 | 137 | 28 | 143 | Os02g0236800 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002451847.1 | 0 | 27 | 137 | 26 | 136 | hypothetical protein SORBIDRAFT_04g008600 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1sch_B | 2e-36 | 25 | 134 | 1 | 109 | A Chain A, Peanut Peroxidase |
PDB | 1sch_A | 2e-36 | 25 | 134 | 1 | 109 | A Chain A, Peanut Peroxidase |
PDB | 1qo4_A | 5e-34 | 25 | 136 | 2 | 112 | A Chain A, Peanut Peroxidase |
PDB | 1pa2_A | 5e-34 | 25 | 136 | 2 | 112 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
PDB | 3atj_B | 2e-30 | 25 | 136 | 2 | 112 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |