y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G407740_T01
FamilyAA2
Protein PropertiesLength: 349 Molecular Weight: 37373.2 Isoelectric Point: 7.5589
ChromosomeChromosome/Scaffold: 10 Start: 116116330 End: 116117984
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2683290
  AHAEDPRMAASLLRMHFHDCFVQGCDASVLLDADGSGRFVTEKRSNPNKDSLRGFEVIDEIKAALEHACPRTVSCADIVAVAARDSVVLTGGPGWEVPLG
  RRDSLTASLSGSNNLIPAPNDSLPTIIGKFANQGLDIVDLVALSGGHTIGDSRCVSFRQRLYGQNNNGQVDRTLNPAYAAELRGRCPRSGGDQNLFALDP
  ASQFRFDNQYYHNILAMDGLLSSDEILLTQSRQTMGLVHRYAADQGLFFDHFAKSMVKMGNI
Full Sequence
Protein Sequence     Length: 349     Download
MARRQQWSRG GLAAVAVLAV LCVLCSGHPV PGGHGSGGGG FVNTLQPHFY DHACPQMQAI    60
VGSVVAKAHA EDPRMAASLL RMHFHDCFVQ GCDASVLLDA DGSGRFVTEK RSNPNKDSLR    120
GFEVIDEIKA ALEHACPRTV SCADIVAVAA RDSVVLTGGP GWEVPLGRRD SLTASLSGSN    180
NLIPAPNDSL PTIIGKFANQ GLDIVDLVAL SGGHTIGDSR CVSFRQRLYG QNNNGQVDRT    240
LNPAYAAELR GRCPRSGGDQ NLFALDPASQ FRFDNQYYHN ILAMDGLLSS DEILLTQSRQ    300
TMGLVHRYAA DQGLFFDHFA KSMVKMGNIS PLTGSAGEIR HNCRRVNH*                360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like2.0e-3863328287+
pfam00141peroxidase4.0e-6661216157+
PLN03030PLN030308.0e-8749347304+
cd00693secretory_peroxidase2.0e-17245346302+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF88307.1043483339unknown [Zea mays]
GenBankACN27649.1013481348unknown [Zea mays]
GenBankEAY94133.104534840344hypothetical protein OsI_15906 [Oryza sativa Indica Group]
RefSeqNP_001052799.104534840344Os04g0423800 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002446477.104534845348hypothetical protein SORBIDRAFT_06g016610 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0453473304A Chain A, Crystal Structure Of A Monocot (Maize Zmglu1) Beta-Glucosidase
PDB1pa2_A0453473304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B0453472294A Chain A, Peanut Peroxidase
PDB1sch_A0453472294A Chain A, Peanut Peroxidase
PDB1gx2_B0453473306A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
Transmembrane Domains
StartEnd
1231
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL855800261743340
HO172957254653180
FF360114256933480
HO180252234652980
CK267747301433430