y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G410916_T02
FamilyGT61
Protein PropertiesLength: 625 Molecular Weight: 67242.7 Isoelectric Point: 6.292
ChromosomeChromosome/Scaffold: 3 Start: 26352719 End: 26355885
DescriptionGlycosyltransferase family 61 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT612414880
  CDFSDFRSDICDLAGDVRMDANVSAFVVVVDPATSGSDQEEHKVRPYPRKGDETCMGRITEVTVRATGDAAGAPRCTETHGAPAVVFSIGGYTGNIFHDF
  SDVLVPLYNTARRYRGDVQLVMANAAPWWLVKYDRLLRALSRHAPLDLARAGAAREVHCFPRAVVSLRAHKELIIERDRSLDGLATPDFTRFLRRALSLP
  RDAPTRLGDGTGRKPRLLVISRHRTRLLLNLDAVVRAAEEVGFEAVVN
Full Sequence
Protein Sequence     Length: 625     Download
MKGDKAGGRD RGGASRPLRL ESQRFRLLSI VVGCFVICLV FLLSSRPDAA AAFGTVSVSP    60
KASLVAARRP VAVKTVRASS SADGALGGDF HVDILPQHRQ EQSLERTGDK TATEWVRDTV    120
IVEERSGAET SEAETEETEP DRHDSATATA AASNTDDQPA VPGAEKAVQD TAAITGQPAA    180
ETTSATAPDG TEKTGAATGG GSGQSKVQEQ PARQRPQEER HDEPAQSGGD QQQQQPRPPL    240
CDFSDFRSDI CDLAGDVRMD ANVSAFVVVV DPATSGSDQE EHKVRPYPRK GDETCMGRIT    300
EVTVRATGDA AGAPRCTETH GAPAVVFSIG GYTGNIFHDF SDVLVPLYNT ARRYRGDVQL    360
VMANAAPWWL VKYDRLLRAL SRHAPLDLAR AGAAREVHCF PRAVVSLRAH KELIIERDRS    420
LDGLATPDFT RFLRRALSLP RDAPTRLGDG TGRKPRLLVI SRHRTRLLLN LDAVVRAAEE    480
VGFEAVVNES DVANDISQVG GLINSCDAMV GVHGAGLTNM MFLPPGAALV QIVPWGGLQW    540
MARADYGDPA EAMGLKYIQY EIGVAESTLK DKFPSGHKIF TNPTALHKKG FMFIRQTLMD    600
GQDITVDVGR FREVLLQVLN SLAQ*                                          660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4421COG44210.0003427534110+
pfam04577DUF5635.0e-16419558145+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP49177.10186129631HGA6 [Hordeum vulgare subsp. vulgare]
DDBJBAF03774.202376238391Os01g0118400 [Oryza sativa Japonica Group]
GenBankEEC69830.10126234560hypothetical protein OsI_00151 [Oryza sativa Indica Group]
RefSeqNP_001041860.10237623137520Os01g0118400 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002455300.101662424626hypothetical protein SORBIDRAFT_03g008020 [Sorghum bicolor]
Transmembrane Domains
StartEnd
2544
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO4500462483375840
EB6681982292895170
FE6498582402564950
FL8706182472234670
CO450046425706110.0000000003