y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G412986_T01
FamilyGT61
Protein PropertiesLength: 568 Molecular Weight: 63059.4 Isoelectric Point: 6.7092
ChromosomeChromosome/Scaffold: 9 Start: 49015041 End: 49020829
DescriptionGlycosyltransferase family 61 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT611724290
  ICDLSDPRYDICEISGDARTMGANRTVLYVPPVGELGSDGQEWSIRDQSRKHLEFVNKVTVKSLNASQSLAAPECTSRHAVRALVFAMNGLTSNPWHDFS
  DVLIPLFITTRALEGEVQFLVSDLQPWFVDKYRLVLKNLSRYDIIDFNQDGGVRCYPHVTVGLRSHRDLGIDPARAPRNYTMLDFRLYIREIYRLPSAGV
  SIPYKEANSNAAAAAPGAPAEQLQRKPRLMLINRGRTRKFVNFPEIVGAVQKAGFEVI
Full Sequence
Protein Sequence     Length: 568     Download
MGADSPPSSS STAPVAGVGA KNTVKQYHRI VVGFLLGFFV VLVLYTTLSS QFGSRTAIGV    60
LQSLSAVRTD QATGAAPPLP SSNTPSNLAQ EEDGGHKNDK PNKTEEEHIQ DDAHRIGKNN    120
QSEAKLEKTG QPAANDASDR MEEELIRQEI DQGSNKNDTI MEPAATAPRK PICDLSDPRY    180
DICEISGDAR TMGANRTVLY VPPVGELGSD GQEWSIRDQS RKHLEFVNKV TVKSLNASQS    240
LAAPECTSRH AVRALVFAMN GLTSNPWHDF SDVLIPLFIT TRALEGEVQF LVSDLQPWFV    300
DKYRLVLKNL SRYDIIDFNQ DGGVRCYPHV TVGLRSHRDL GIDPARAPRN YTMLDFRLYI    360
REIYRLPSAG VSIPYKEANS NAAAAAPGAP AEQLQRKPRL MLINRGRTRK FVNFPEIVGA    420
VQKAGFEVIP IEPRRDLSVE DFARTVDSCD VLMGAHGAGL TNFFFLRTNA VMLQVVPWGH    480
MEHPSMAFYG GPAKEMRLRD VEYSIADVES TLYDKYGKDN PVVSDPESIH KQGWQLGMRY    540
YWIEQDIRLN VTRFAPTLQK VLQMIRE*                                       600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4421COG44210.00339848994+
pfam04577DUF5632.0e-1239548492+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG31877.1015671577glycosyltransferase [Zea mays]
GenBankEAZ08408.101415661409hypothetical protein OsI_30669 [Oryza sativa Indica Group]
GenBankEEE56874.109256589548hypothetical protein OsJ_06512 [Oryza sativa Japonica Group]
RefSeqNP_001057635.10118566101533Os06g0475400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001140978.1015671567hypothetical protein LOC100273057 [Zea mays]
Transmembrane Domains
StartEnd
3052
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE01512624112410
CJ8262562891354220
EE0151251773925680
CV7613042371674030
FL31510923212220