CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G422938_T02
FamilyGH13
Protein PropertiesLength: 425 Molecular Weight: 48508.6 Isoelectric Point: 5.543
ChromosomeChromosome/Scaffold: 2 Start: 60765875 End: 60770124
Descriptionalpha-amylase-like 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH13473445.2e-34
  EKVTDLAESGFTSVWLPPPTQSLSREGYLPQNLYCLDSCYGSLHELKLLLHKMSEHNVRAMADVVINHRIGTTQGSNGMYNRYDGIPVSWDEHAVTSCSG
  GKGNKSTGDNFDGVPNIDHTQPFVRKDIIEWLIWLRKSVGFQDFRFDFTKGYAAKFVKEYIEESKPLFAVGEYWDSCEYSPPDYRLNYNQDVLVSFCLPD
  IHRQRIINWIDNTGGLCAAFDFTTKGILQEAVKGELWRLRDSEGKPPGVMGWWPSRSVTFIENHDTGSTQGHWPFPSDHIMEGYAYILTHPGIPTVFY
Full Sequence
Protein Sequence     Length: 425     Download
MGQMISGDKS DEQTARDDGI IKNGREILFQ AFNWESNKHN WWSILEEKVT DLAESGFTSV    60
WLPPPTQSLS REGYLPQNLY CLDSCYGSLH ELKLLLHKMS EHNVRAMADV VINHRIGTTQ    120
GSNGMYNRYD GIPVSWDEHA VTSCSGGKGN KSTGDNFDGV PNIDHTQPFV RKDIIEWLIW    180
LRKSVGFQDF RFDFTKGYAA KFVKEYIEES KPLFAVGEYW DSCEYSPPDY RLNYNQDVLV    240
SFCLPDIHRQ RIINWIDNTG GLCAAFDFTT KGILQEAVKG ELWRLRDSEG KPPGVMGWWP    300
SRSVTFIENH DTGSTQGHWP FPSDHIMEGY AYILTHPGIP TVFYDHFYDQ GVPLHDEIAK    360
LMQIRKCQDI HSRSSIKILE VGSDLYSAII DDKLCMKIGD GSWCPSDPEW RLAVSGDRYA    420
VWHK* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK09441PRK094412.0e-4423366426+
PLN00196PLN001962.0e-13926424415+
cd11314AmyAc_arch_bac_plant_AmyA9.0e-15627376354+
PLN02784PLN027846.0e-16523424409+
PLN02361PLN02361015424410+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004556alpha-amylase activity
GO:0005509calcium ion binding
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE02023.2044241412OSJNBb0118P14.5 [Oryza sativa (japonica cultivar-group)]
EMBLCAX51375.1014241415alpha-amylase [Hordeum vulgare subsp. vulgare]
RefSeqNP_001052697.10242431444Os04g0403300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001141482.1014241415hypothetical protein LOC100273593 [Zea mays]
RefSeqXP_002446386.1014241415hypothetical protein SORBIDRAFT_06g015110 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bg9_A0264241402A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
PDB1ava_B0264241402A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
PDB1ava_A0264241402A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
PDB1amy_A0264241402A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
PDB3bsg_A0264242404A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BU10370642514250
HO78066141884250
HO798064379203980
CO522510248743210
HO798064333934250.00001