y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G431039_T01
FamilyCBM43
Protein PropertiesLength: 648 Molecular Weight: 68628 Isoelectric Point: 7.1908
ChromosomeChromosome/Scaffold: 7 Start: 155070032 End: 155072773
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433874679.8e-32
  WCVANAAVGDDRLQQALDYACGHGADCSAIQPSGSCFEPDTKLAHASYAFDSYYQRNGRATSACDFSGAASIVYQAPAVTC
CBM434745511.3e-32
  WCVAKPGAGGAQLQQALDYACGHGADCSAIQSGGSCFQPDTVAAHASYAFNSYYQRNGRARVACDFSGAGSIVYQQPS
CBM435596401.8e-33
  WCVANPGVGDARLQTALDYACGHGADCRAIQPGGACFQPDNKASHASYAFNGYYQRNNRARVACDFSGAGSIVYQQPKVGNC
GH17263680
  VGVNYGMVANDLPNPASVVQLLKQNGITMVKIYDANATVLTSLANTGIKAMVMMPNQNLAHAARDPVYAAQWVQDNVKKYLPRTQINAVAVGNEVFDDPN
  VDKMTLVPAMKNVQKALADLGLANAVKVSTPIAFSAVRDSFPPSGSRFRDDIAQPVMKPMLQLLQRTGSFLTVNIYPCLTQMQQPDDIPLDYALGNAQHA
  VLDGSNKYYSLLDAQLDATHYAMEALGFGNVEAVLGETGCPNKGKIGKHRPPRRGVGSSRRRLLDDGGSEPEASVANARAYNNYVINRVLSGNTGTPHRP
  RADMHVYIFALFNENNKSADPDDVENNFGLFYPNMQKIYDFNF
Full Sequence
Protein Sequence     Length: 648     Download
MAFTLRLGTA FLVLLLFSCA AEAGEVGVNY GMVANDLPNP ASVVQLLKQN GITMVKIYDA    60
NATVLTSLAN TGIKAMVMMP NQNLAHAARD PVYAAQWVQD NVKKYLPRTQ INAVAVGNEV    120
FDDPNVDKMT LVPAMKNVQK ALADLGLANA VKVSTPIAFS AVRDSFPPSG SRFRDDIAQP    180
VMKPMLQLLQ RTGSFLTVNI YPCLTQMQQP DDIPLDYALG NAQHAVLDGS NKYYSLLDAQ    240
LDATHYAMEA LGFGNVEAVL GETGCPNKGK IGKHRPPRRG VGSSRRRLLD DGGSEPEASV    300
ANARAYNNYV INRVLSGNTG TPHRPRADMH VYIFALFNEN NKSADPDDVE NNFGLFYPNM    360
QKIYDFNFRG GGGGGGQPPA GPAAASWCVA NAAVGDDRLQ QALDYACGHG ADCSAIQPSG    420
SCFEPDTKLA HASYAFDSYY QRNGRATSAC DFSGAASIVY QAPAVTCSSA KPSWCVAKPG    480
AGGAQLQQAL DYACGHGADC SAIQSGGSCF QPDTVAAHAS YAFNSYYQRN GRARVACDFS    540
GAGSIVYQQP SFCAATASWC VANPGVGDAR LQTALDYACG HGADCRAIQP GGACFQPDNK    600
ASHASYAFNG YYQRNNRARV ACDFSGAGSI VYQQPKVGNC VLPSNAG*                 660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X82.0e-2447354477+
smart00768X85.0e-3139446977+
smart00768X86.0e-3755864184+
smart00768X87.0e-3847355280+
pfam00332Glyco_hydro_174.0e-9626368343+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001151472.1035527556hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
RefSeqNP_001151472.10473646391566hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
RefSeqXP_002462968.102155224557hypothetical protein SORBIDRAFT_02g035490 [Sorghum bicolor]
RefSeqXP_002462968.10473646392566hypothetical protein SORBIDRAFT_02g035490 [Sorghum bicolor]
RefSeqXP_002462970.102464623661hypothetical protein SORBIDRAFT_02g035520 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0263681312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D0253681315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C0253681315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_B0253681315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_A0253681315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC89916727412740
EE17759727322740
EC88843326812680
EC8884321854646480
EC8884321573945500