CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G431856_T01
FamilyCE8
Protein PropertiesLength: 390 Molecular Weight: 41857.8 Isoelectric Point: 9.56
ChromosomeChromosome/Scaffold: 4 Start: 2050240 End: 2051608
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8803780
  YVVDPSGKGDYTNITAALEDIPVSNTKRVILDLKPGAQFREKLFLNISKPFITFRSDPKKPAVVVWNDTAATNGKDGKPVGTVGSATLAVESDYFTAYGV
  VFRNDAPLAKPGAKGGQAVAVRLFGTKTQIYNCTIDGGQDTLYDHKGLHYFKGCLIRGSVDFIFGFGRSFYEDCRIESVVKEVAVLTAQQRSKSIEGAID
  TGFSFKNCSIGGVKGGQIYLGRAWGDSSRVVYSYTKMGEEVVPVGWDGWQIAKPESSGIYYGEFKCFGPGADAKKKKRVGWALDLTEAQAKPFVGTHYV
Full Sequence
Protein Sequence     Length: 390     Download
MAQRAVATMT TNKPLLLLAL ASALLGAAPA AANAPGGAFS NWVAMNQQSY ALYAQKSVGD    60
GGKEPLDKKL SEAEKKKVTY VVDPSGKGDY TNITAALEDI PVSNTKRVIL DLKPGAQFRE    120
KLFLNISKPF ITFRSDPKKP AVVVWNDTAA TNGKDGKPVG TVGSATLAVE SDYFTAYGVV    180
FRNDAPLAKP GAKGGQAVAV RLFGTKTQIY NCTIDGGQDT LYDHKGLHYF KGCLIRGSVD    240
FIFGFGRSFY EDCRIESVVK EVAVLTAQQR SKSIEGAIDT GFSFKNCSIG GVKGGQIYLG    300
RAWGDSSRVV YSYTKMGEEV VPVGWDGWQI AKPESSGIYY GEFKCFGPGA DAKKKKRVGW    360
ALDLTEAQAK PFVGTHYVLG DTWIQPPPK* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02304PLN023047.0e-7979386318+
PLN02634PLN026341.0e-8281386306+
PLN02671PLN026712.0e-8381385308+
PLN02682PLN026821.0e-10279386309+
PLN02665PLN026651.0e-10542389349+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF22736.10143884380pectinesterase family protein [Brachypodium distachyon]
GenBankACF82787.1013891389unknown [Zea mays]
RefSeqNP_001068464.102438832398Os11g0683700 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001144148.1013891389hypothetical protein LOC100277001 [Zea mays]
RefSeqXP_002451275.103338736395hypothetical protein SORBIDRAFT_05g026816 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A2e-308138510309A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A1e-26813856305B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB3uw0_A8e-168137334353A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2ntq_B0.000000000000029038818342A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2ntq_A0.000000000000029038818342A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
Signal Peptide
Cleavage Site
32
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV52807330313030
DV52837029212920
DR96314128912890
DR80918428612860
DR97284828012800