CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G446515_T05
FamilyGH14
Protein PropertiesLength: 680 Molecular Weight: 75680.4 Isoelectric Point: 5.2004
ChromosomeChromosome/Scaffold: 7 Start: 62300598 End: 62305837
Descriptionbeta-amylase 7
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH142456620
  YVMLPLGVVNGNGEVVDADELVGQLRVLKASGVDGVMVDCWWGNVEAHKPQEYNWTGYRRLFQMIRELKLKLQVVMSFHECGGNVGDDISIPLPHWVIEI
  GRSNPDIYFTDRAGRRNTECLSWGVDKERVLQGRTAVEVYFDFMRSFRVEFDEYFEDGIISEIEIGLGACGELRYPSYPAKHGWKYPGIGEFQCYDRYLQ
  KSLRKAAEARGHTIWARGPDNAGHYNSEPNLTGFFCDGGDYDSYYGRFFLSWYSQALVDHADRVLMLARLAFEGTNIAVKVSGVHWWYKTASHAAELTAG
  FYNPCNRDGYAPIAAVLKKYDAALNFTCVELRTMDQHEVYPEAFADPEGLVWQVLNAAWDAGIQVASENALPCYDRDGFNKILENAKPLNDPDGRHLLGF
  TYLRLGKDLFERPNFFEF
Full Sequence
Protein Sequence     Length: 680     Download
MQQAGLADDD DEEIWVKEED DEEEEDGYYM DPRSPAVWTP GGRAGGTSNR RRAREEKERT    60
KMRERQRRAI TGRILAGLRQ HGNYRLRARA DINEVIAALA REAGWVVLPD GTTFPSSSSF    120
AAVAAQPPRP VMVAAASPSA TPLALPASSA LPLRGIAPVA ARPISHRPAP AFALLLPPRA    180
AAASRSPADD VPDGNSSHLL AVPVPVPMDP AAAEDVPVAK QLQVPDVSPR PPERDFAGTP    240
YVPVYVMLPL GVVNGNGEVV DADELVGQLR VLKASGVDGV MVDCWWGNVE AHKPQEYNWT    300
GYRRLFQMIR ELKLKLQVVM SFHECGGNVG DDISIPLPHW VIEIGRSNPD IYFTDRAGRR    360
NTECLSWGVD KERVLQGRTA VEVYFDFMRS FRVEFDEYFE DGIISEIEIG LGACGELRYP    420
SYPAKHGWKY PGIGEFQCYD RYLQKSLRKA AEARGHTIWA RGPDNAGHYN SEPNLTGFFC    480
DGGDYDSYYG RFFLSWYSQA LVDHADRVLM LARLAFEGTN IAVKVSGVHW WYKTASHAAE    540
LTAGFYNPCN RDGYAPIAAV LKKYDAALNF TCVELRTMDQ HEVYPEAFAD PEGLVWQVLN    600
AAWDAGIQVA SENALPCYDR DGFNKILENA KPLNDPDGRH LLGFTYLRLG KDLFERPNFF    660
EFERFIKRMH GEAVLDLQV* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02705PLN027052.0e-1531131101+
PLN02905PLN029055.0e-216913062+
PLN02905PLN029050223679457+
PLN02705PLN027050224672449+
PLN02801PLN028010241672438+
Gene Ontology
GO TermDescription
GO:0000272polysaccharide catabolic process
GO:0016161beta-amylase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG29023.1012267910567beta-amylase [Zea mays]
GenBankEEC85090.104667944651hypothetical protein OsI_32458 [Oryza sativa Indica Group]
GenBankEEE70265.104667943650hypothetical protein OsJ_30408 [Oryza sativa Japonica Group]
RefSeqNP_001063976.1021667969533Os09g0569200 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002459849.102086791469hypothetical protein SORBIDRAFT_02g012320 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1byd_A024167211444A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue
PDB1byc_A024167211444A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue
PDB1byb_A024167211444A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue
PDB1bya_A024167211444A Chain A, Crystal Structures Of Soybean Beta-Amylase Reacted With Beta-Maltose And Maltal: Active Site Components And Their Apparent Role In Catalysis
PDB1wdp_A024167211444A Chain A, Crystal Structures Of Soybean Beta-Amylase Reacted With Beta-Maltose And Maltal: Active Site Components And Their Apparent Role In Catalysis
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV0211502923276180
CO4472862893196070
DY4022162443465890
FF3595782632815430
JG8149582492735210