y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G450125_T02
FamilyGH14
Protein PropertiesLength: 391 Molecular Weight: 43244.6 Isoelectric Point: 5.2738
ChromosomeChromosome/Scaffold: 1 Start: 9057059 End: 9060022
Descriptionbeta-amylase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH14173460
  VCSIPLPGWVLEEMDKDQDLAYTDRSGRRNYEYVSLGCDAMPVLKGRTPIQCYADFMRAFRDHFATFMGNTIVEIQVGMGPAGELRYPSYPESDGTWSFP
  GIGEFQCYDRFMLSSLKAAAEAVGKPEWGNAGPGDSGSYKDWPEDTGFFRREGGWSTEYGEFFMSWYSQMLLEHGERILSAATGVFTGSPGVKISVKVAG
  IHWHYGTRSHAAELTAGYYNTRSHDGYAPIARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREAGVGLAGENALPRYDDTAHDQVVATA
  ADRAAEDRMVAFTYLRMGPDLFQPDNWRRF
Full Sequence
Protein Sequence     Length: 391     Download
MLSFLVSCHV ILHALVVCSI PLPGWVLEEM DKDQDLAYTD RSGRRNYEYV SLGCDAMPVL    60
KGRTPIQCYA DFMRAFRDHF ATFMGNTIVE IQVGMGPAGE LRYPSYPESD GTWSFPGIGE    120
FQCYDRFMLS SLKAAAEAVG KPEWGNAGPG DSGSYKDWPE DTGFFRREGG WSTEYGEFFM    180
SWYSQMLLEH GERILSAATG VFTGSPGVKI SVKVAGIHWH YGTRSHAAEL TAGYYNTRSH    240
DGYAPIARML ARHGAVLNFT CVEMRDHEQP QDAQCRPEAL VQQVAAAARE AGVGLAGENA    300
LPRYDDTAHD QVVATAADRA AEDRMVAFTY LRMGPDLFQP DNWRRFAAFV KRMTEPGARE    360
ACREQVEREA EGVAHATQPL VHEAAVALTN *                                   420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02905PLN029055.0e-9717353343+
PLN02161PLN021612.0e-10020354342+
PLN02801PLN028013.0e-13317353344+
PLN00197PLN00197018390378+
PLN02803PLN02803018364347+
Gene Ontology
GO TermDescription
GO:0000272polysaccharide catabolic process
GO:0016161beta-amylase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG29617.1018390200572beta-amylase [Zea mays]
GenBankEAY88485.1018390184556hypothetical protein OsI_09956 [Oryza sativa Indica Group]
RefSeqNP_001048926.1018390185557Os03g0141200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001148159.1018390201573beta-amylase [Zea mays]
RefSeqXP_002468533.1018390192564hypothetical protein SORBIDRAFT_01g047500 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1q6d_A0135375441A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant (M51t) With Increased Ph Optimum
PDB1wdp_A0135375441A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant (M51t) With Increased Ph Optimum
PDB1q6c_A0135375441A Chain A, Crystal Structure Of Soybean Beta-Amylase Complexed With Maltose
PDB1bfn_A0135375441A Chain A, Crystal Structure Of Soybean Beta-Amylase Complexed With Maltose
PDB1uko_D0135375441A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted At Surface Region
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV164966290833720
DV509016278813580
EE162434275453190
HO779314376183880
DV164014270483170