y
Basic Information | |
---|---|
Species | Zea mays |
Cazyme ID | GRMZM2G460406_T02 |
Family | AA2 |
Protein Properties | Length: 164 Molecular Weight: 18062.6 Isoelectric Point: 6.9746 |
Chromosome | Chromosome/Scaffold: 4 Start: 216673396 End: 216687590 |
Description | ascorbate peroxidase 3 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 7 | 117 | 3.9e-28 |
KKSAPHLRDIFYRMGLSDKDIVALSGGHTLGRAHPERSGFDGAWTKEPLKFDNSYFLELLNEESEGLLKLPTDKALLSDPEFRRYVELYAKDEDAFFKDY AESHKKLSELG |
Full Sequence |
---|
Protein Sequence Length: 164 Download |
MVRLDMKKSA PHLRDIFYRM GLSDKDIVAL SGGHTLGRAH PERSGFDGAW TKEPLKFDNS 60 YFLELLNEES EGLLKLPTDK ALLSDPEFRR YVELYAKDED AFFKDYAESH KKLSELGFTP 120 RSTAPSKSDL PTAAVLAQSA FGVAVAAAVV IAGYLYEASK KAK* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00693 | secretory_peroxidase | 5.0e-20 | 9 | 117 | 147 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
PLN02364 | PLN02364 | 4.0e-40 | 5 | 118 | 115 | + L-ascorbate peroxidase 1 | ||
PLN02879 | PLN02879 | 4.0e-45 | 8 | 121 | 114 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 3.0e-64 | 3 | 120 | 123 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN02608 | PLN02608 | 2.0e-88 | 5 | 163 | 159 | + L-ascorbate peroxidase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACF84871.1 | 0 | 5 | 163 | 131 | 289 | unknown [Zea mays] |
DDBJ | BAB62533.1 | 0 | 5 | 163 | 131 | 291 | peroxisome type ascorbate peroxidase [Hordeum vulgare subsp. vulgare] |
GenBank | EAZ10942.1 | 0 | 5 | 163 | 81 | 241 | hypothetical protein OsJ_00785 [Oryza sativa Japonica Group] |
RefSeq | NP_001132505.1 | 0 | 5 | 163 | 131 | 289 | hypothetical protein LOC100193965 [Zea mays] |
RefSeq | XP_002444620.1 | 0 | 5 | 163 | 131 | 289 | hypothetical protein SORBIDRAFT_07g024880 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3zcy_A | 0 | 5 | 118 | 132 | 246 | A Chain A, Ascorbate Peroxidase W41a-h42y Mutant |
PDB | 2y6a_A | 0 | 5 | 118 | 132 | 246 | A Chain A, Ascorbate Peroxidase R38a Mutant |
PDB | 3zcg_A | 0 | 5 | 118 | 144 | 258 | A Chain A, Ascorbate Peroxidase W41a-h42c Mutant |
PDB | 2y6b_A | 0 | 5 | 118 | 132 | 246 | A Chain A, Ascorbate Peroxidase R38k Mutant |
PDB | 3zch_A | 0 | 5 | 118 | 144 | 258 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |