CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G480074_T01
FamilyGT77
Protein PropertiesLength: 552 Molecular Weight: 61690 Isoelectric Point: 6.1562
ChromosomeChromosome/Scaffold: 6 Start: 158445255 End: 158448486
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT773005200
  VTNFLVCALDHETYEFSILQGLPVFRDPLSPTNVSFDDCHFGTKCFQQVTKVKSRIVLEILRLGYNVLLSDVDVYWFGNPMPLLYSLGLATFGAQSDEYN
  ETGPINLPRRLNSGFYFARSDNATIIAMEMIVKHAASSGLSEQPSFYDVLCGENGTNRIGEDRCLEPNTNLTVVFLDRDLFPNGAYKGLWEKRDVRATCK
  ELGCFIIHNNWINKRRKKVHR
Full Sequence
Protein Sequence     Length: 552     Download
MVARAQAAAD TDVCVLVDAE IVLLPEIVNA LDRFSKVDGD WFLVSLSRNV TDPRYQLADS    60
GSHWVQADGK EVSFTEEIPA EWSSSEGSDR GLIMAWNNPS SALHAGVLPS FLYGRGAQNW    120
WLAHEVLSSE MRLFFDASSL VLGLYPESIS AMQHVMASSK NGRLPSVSWE YGVNHHLAAV    180
YGSYCCRSPA RRFPMLHRVV KQSEDYMLSK VDTLVSSDFF ISKQGNAHGV DSLRKKQNVS    240
LSGYLHGCSS ETSAPDLPYS LSMLLDLVAD ENGSVVLGVA GKSYRDMLMS WACRLRRLRV    300
TNFLVCALDH ETYEFSILQG LPVFRDPLSP TNVSFDDCHF GTKCFQQVTK VKSRIVLEIL    360
RLGYNVLLSD VDVYWFGNPM PLLYSLGLAT FGAQSDEYNE TGPINLPRRL NSGFYFARSD    420
NATIIAMEMI VKHAASSGLS EQPSFYDVLC GENGTNRIGE DRCLEPNTNL TVVFLDRDLF    480
PNGAYKGLWE KRDVRATCKE LGCFIIHNNW INKRRKKVHR QMVSGLWDYD PTSRQCLQEW    540
SAQNDGAIPF V* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans1.0e-46300521223+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAU03099.101541219748hypothetical protein [Oryza sativa Japonica Group]
DDBJBAH93216.101541143672Os05g0513700 [Oryza sativa Japonica Group]
GenBankEEC79523.101541282813hypothetical protein OsI_20607 [Oryza sativa Indica Group]
GenBankEEE64343.101541143674hypothetical protein OsJ_19183 [Oryza sativa Japonica Group]
RefSeqXP_002441368.101541182721hypothetical protein SORBIDRAFT_09g025390 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DN2292052591454030
EL3424482572885440
EX1364522961964890
EL3544682812575370
EH6740232352474770