y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G538064_T01
FamilyGH9
Protein PropertiesLength: 498 Molecular Weight: 54120.5 Isoelectric Point: 7.972
ChromosomeChromosome/Scaffold: 5 Start: 211990624 End: 211992733
Descriptionglycosyl hydrolase 9A4
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9384840
  DYKDALSKTIIFLEAQRSGKLPRSNRVKWRGDSGLDDGKLANVDLTGGYYDAGDNVKYGLPLAFTVTTLAWTALAFKPELESTKELKHVHQAIKWGTDYL
  LKCAARKNKLWVQVGDPNLDHQCWVRPENMKAPRTLYEIDSKTPGTEIAAETSAAFAASSMVFRDDKKYSRKLLNKAKLLFTFAKSHLGSYDGECPFYCS
  YSGYNDELLWAATWLYLATRRQVYADFIAHEAISSSVAEFSWDLKFPGAQVLLAEFNMTSAGGAQNFKSQADNFVCAVLPDTAFHQVFITPGGVIHLRDG
  ANSQYVTSTAFLLVVYADLLLRTGQTVLCGNQPLPPARLHEFARQQMDYLLGANPRHSSYVVGFGANPPTQPHHRGASTPVLPPGTDVNCGLSFGDWMAP
  DKPNPNELTGAIVGGPDKNDGFVDKRGNSSYTEPCTYINSLAIGPLA
Full Sequence
Protein Sequence     Length: 498     Download
MRAPRHGSMR AHVALAFAAL VLAGDALQPA LAGGCGFDYK DALSKTIIFL EAQRSGKLPR    60
SNRVKWRGDS GLDDGKLANV DLTGGYYDAG DNVKYGLPLA FTVTTLAWTA LAFKPELEST    120
KELKHVHQAI KWGTDYLLKC AARKNKLWVQ VGDPNLDHQC WVRPENMKAP RTLYEIDSKT    180
PGTEIAAETS AAFAASSMVF RDDKKYSRKL LNKAKLLFTF AKSHLGSYDG ECPFYCSYSG    240
YNDELLWAAT WLYLATRRQV YADFIAHEAI SSSVAEFSWD LKFPGAQVLL AEFNMTSAGG    300
AQNFKSQADN FVCAVLPDTA FHQVFITPGG VIHLRDGANS QYVTSTAFLL VVYADLLLRT    360
GQTVLCGNQP LPPARLHEFA RQQMDYLLGA NPRHSSYVVG FGANPPTQPH HRGASTPVLP    420
PGTDVNCGLS FGDWMAPDKP NPNELTGAIV GGPDKNDGFV DKRGNSSYTE PCTYINSLAI    480
GPLAALAVRG VQLVATQ*                                                  540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02171PLN021711.0e-14432487472+
PLN02266PLN022662.0e-15038487462+
pfam00759Glyco_hydro_99.0e-15938484462+
PLN02613PLN026133.0e-17038486459+
PLN02909PLN02909030489461+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF86783.1014971497unknown [Zea mays]
GenBankEAZ07843.102349726501hypothetical protein OsI_30101 [Oryza sativa Indica Group]
RefSeqNP_001048297.102349726501Os02g0778600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151937.1014971497endoglucanase [Zea mays]
RefSeqXP_002452914.1014971497hypothetical protein SORBIDRAFT_04g034920 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0374903432A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB1ksc_A0374903432A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB1ks8_A0374903432A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B0374864440A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A0374864440A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV0297702791163940
DR8009032771053810
DR818195278283050
DR81843229612960
EB164797276483230