| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G557799_T01 |
| Family | AA2 |
| Protein Properties | Length: 219 Molecular Weight: 23703.4 Isoelectric Point: 9.2157 |
| Chromosome | Chromosome/Scaffold: 2 Start: 178407364 End: 178411287 |
| Description | thylakoidal ascorbate peroxidase |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 59 | 146 | 2.5e-23 |
| WHDAGTYDKNIIEWPKCSGANGSLRFKVELKHGANADLVNALKLIQPIKDKFSSVTYADLFQLASAIAIEEAGVPKIPMIYGRVDVIA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 219 Download |
| MENRTASVST YQRGNGCQPV TATTIYGHMY LVTSCIAISG SSVPCVPRKA TVLQQPTGWH 60 DAGTYDKNII EWPKCSGANG SLRFKVELKH GANADLVNAL KLIQPIKDKF SSVTYADLFQ 120 LASAIAIEEA GVPKIPMIYG RVDVIALDNA RQRGGFLRFY RIANLQLRGT IKSCFSVIIV 180 RILDEPTIKD NAGVIVNPKG DMKGFAITGP IDKECANL* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00314 | plant_peroxidase_like | 9.0e-17 | 59 | 143 | 90 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
| PLN02364 | PLN02364 | 5.0e-17 | 58 | 143 | 86 | + L-ascorbate peroxidase 1 | ||
| pfam00141 | peroxidase | 1.0e-17 | 59 | 143 | 92 | + Peroxidase. | ||
| PLN02608 | PLN02608 | 3.0e-25 | 59 | 162 | 112 | + L-ascorbate peroxidase | ||
| cd00691 | ascorbate_peroxidase | 2.0e-45 | 58 | 161 | 115 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003735 | structural constituent of ribosome |
| GO:0004601 | peroxidase activity |
| GO:0005840 | ribosome |
| GO:0006412 | translation |
| GO:0006979 | response to oxidative stress |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACN27920.1 | 0 | 58 | 146 | 71 | 159 | unknown [Zea mays] |
| GenBank | EEE52862.1 | 0 | 58 | 154 | 67 | 163 | hypothetical protein OsJ_35415 [Oryza sativa Japonica Group] |
| RefSeq | NP_001066305.1 | 0 | 58 | 154 | 67 | 163 | Os12g0178100 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001132299.1 | 0 | 58 | 154 | 71 | 167 | hypothetical protein LOC100193740 [Zea mays] |
| RefSeq | XP_002441920.1 | 0 | 58 | 154 | 71 | 167 | hypothetical protein SORBIDRAFT_08g004880 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1iyn_A | 2.94273e-44 | 58 | 154 | 32 | 128 | A Chain A, Crystal Structure Of Chloroplastic Ascorbate Peroxidase From Tobacco Plants And Structural Insights For Its Instability |
| PDB | 1apx_D | 7e-17 | 59 | 143 | 40 | 120 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 1apx_C | 7e-17 | 59 | 143 | 40 | 120 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 1apx_B | 7e-17 | 59 | 143 | 40 | 120 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 1apx_A | 7e-17 | 59 | 143 | 40 | 120 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| Hydropathy |
|---|
 |