y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM5G828603_T01
FamilyGH35
Protein PropertiesLength: 599 Molecular Weight: 66725.6 Isoelectric Point: 8.5071
ChromosomeChromosome/Scaffold: 3 Start: 201769901 End: 201774206
DescriptionRAN GTPase activating protein 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH352733534e-21
  LHFHNNMTRDEVELNKQISCTLPLTNKTNKQVTFKFKYHGGTNFGRTSGGPYITTSYDYDAPLDEYGNIRQPKYGHLKDLH
Full Sequence
Protein Sequence     Length: 599     Download
MREMISRSTQ GNGETHGEEV SGIKDVVTQK DTTKPTNIDL MPRCGVTEDD TRRGPAKRHL    60
RPPTPGTGAQ AHRRHELYAK ESSKMMLEVL RKGPRTTAEL EAPVADTSLV SADAPRVLAD    120
IVLDISGGEH AFIEADETKE LLSPLTKPGN SYKRICFSNR SFGIGAANVA GPILDSVKNQ    180
LTKVDISDFV AGRSEDEALD VMRIFSKALE GSVLRYLNIS DNALGEKDVR AFNELLKSQE    240
SLEELYVMND GISEEAAKAL YELIPATEKL KVLHFHNNMT RDEVELNKQI SCTLPLTNKT    300
NKQVTFKFKY HGGTNFGRTS GGPYITTSYD YDAPLDEYGN IRQPKYGHLK DLHDLIRSME    360
KILVHGKYND TSYGKNAIFV DRDVKVTLSG GTHLVPAWSV SILPDCKTVA YNTAKIKTQT    420
SVMVKKANSV EKEPEALRWS WMPENLKPFM TDHRDSFRHS QLLEQITTST DQSDYLWYRT    480
SLEHKGEGSY TLYVNTSGHE MAKLLGRWSV RLPAPVSGEA PLRKELRFSP QRHSRTQGQN    540
YSADGAFVFQ LQSPVKLHSG KNYVSLLSGT VGLKSAKTLV IVVENPDKFR VVAFSAHF*     600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5238RNA10.004137263135+
PLN02696PLN026960.000151159691+
pfam13943WPP9.0e-67610328+
pfam01301Glyco_hydro_354.0e-2031035347+
PLN03059PLN030592.0e-45308573290+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG32377.105628368285ran GTPase activating protein [Zea mays]
GenBankACL52836.105628368285unknown [Zea mays]
GenBankACN27651.10308575290547unknown [Zea mays]
RefSeqNP_001130411.105628368285hypothetical protein LOC100191507 [Zea mays]
RefSeqXP_002457961.10308583295559hypothetical protein SORBIDRAFT_03g023500 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A0.005301352269325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR878562228562830
FL711714228562830
GO844309229562840
GO854377235492830
GD042233230542830