y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM5G829293_T01
FamilyGH3
Protein PropertiesLength: 152 Molecular Weight: 16150.2 Isoelectric Point: 5.6883
ChromosomeChromosome/Scaffold: 7 Start: 144927460 End: 144928528
DescriptionGlycosyl hydrolase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH341525.60519e-45
  IVQAIGREARALYNLGQAEGLTIWSPNVNIFRDPRWGRGQETPGEDPAVASKYAVAFVRGIQGSNPAGAAAAPLQASACCKHATAYDLEDWNGVARYNFD
  ARVTLQDLADTFNPPFQSCVVDGKASCVMCAYTVINGVPACASSDLLTK
Full Sequence
Protein Sequence     Length: 152     Download
MHGIVQAIGR EARALYNLGQ AEGLTIWSPN VNIFRDPRWG RGQETPGEDP AVASKYAVAF    60
VRGIQGSNPA GAAAAPLQAS ACCKHATAYD LEDWNGVARY NFDARVTLQD LADTFNPPFQ    120
SCVVDGKASC VMCAYTVING VPACASSDLL TK                                  180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK15098PRK150981.0e-136150150+
COG1472BglX4.0e-186152150+
pfam00933Glyco_hydro_36.0e-326152148+
PLN03080PLN030801.0e-674152153+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAX92971.104152129272beta-D-xylosidase [Oryza sativa Japonica Group]
GenBankEAY80660.104152129272hypothetical protein OsI_35838 [Oryza sativa Indica Group]
RefSeqXP_002489304.104152121268hypothetical protein SORBIDRAFT_0010s007570 [Sorghum bicolor]
RefSeqXP_002489310.104151134277hypothetical protein SORBIDRAFT_0010s010920 [Sorghum bicolor]
RefSeqXP_002489311.104152151300hypothetical protein SORBIDRAFT_0010s012040 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3u4a_B0.00000000000015151105244A Chain A, Crystal Structure Of The Putative Acetylxylan Esterase From Clostridium Acetobutylicum, Northeast Structural Genomics Target Car6
PDB3u4a_A0.00000000000015151105244A Chain A, Crystal Structure Of The Putative Acetylxylan Esterase From Clostridium Acetobutylicum, Northeast Structural Genomics Target Car6
PDB3u48_B0.00000000000015151105244A Chain A, Crystal Structure Of The Putative Acetylxylan Esterase From Clostridium Acetobutylicum, Northeast Structural Genomics Target Car6
PDB3u48_A0.00000000000015151105244A Chain A, Crystal Structure Of The Putative Acetylxylan Esterase From Clostridium Acetobutylicum, Northeast Structural Genomics Target Car6
PDB4i3g_B0.00000000000026150134257A Chain A, Crystal Structure Of Desr, A Beta-glucosidase From Streptomyces Venezuelae In Complex With D-glucose.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL09290515211520
FL88018114941520
FL87409114941520
FL85481814941520
CA17074714751510