CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM5G837822_T01
FamilyGH18
Protein PropertiesLength: 312 Molecular Weight: 32398.7 Isoelectric Point: 9.0777
ChromosomeChromosome/Scaffold: 3 Start: 176570295 End: 176571270
Descriptionchitinase A
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18352593e-26
  IAIYWGQNGNEGTLAQTCATGNYRFVNVAFLPTFGRGQTPALNLAGHCDPASGGCTGVGADVKACQRMGVKVLLSIGGGVGSYGLSSRADARSVAAYLWD
  NYLGGGGSESRPLGDAVLDGVDFDIESGGGMYWDDLARFLKSYSRRGRGRARRPVYLSAAPQCPFPDASLGTALATGLFDYVWVQFYNNPPCQYSASAGV
  GSLAQAWAQWTSIRAGRVFLGLPAA
Full Sequence
Protein Sequence     Length: 312     Download
MGRRSSQFPS MALAMATVLM ALGGVAATAR AGGGIAIYWG QNGNEGTLAQ TCATGNYRFV    60
NVAFLPTFGR GQTPALNLAG HCDPASGGCT GVGADVKACQ RMGVKVLLSI GGGVGSYGLS    120
SRADARSVAA YLWDNYLGGG GSESRPLGDA VLDGVDFDIE SGGGMYWDDL ARFLKSYSRR    180
GRGRARRPVY LSAAPQCPFP DASLGTALAT GLFDYVWVQF YNNPPCQYSA SAGVGSLAQA    240
WAQWTSIRAG RVFLGLPAAP QAAGSGFVPA SDLVAQVLPV VKNSTKYGGI MLWSRYYDGL    300
TGYSDAVKSY V* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00598GH18_chitinase-like2.0e-598222134+
COG3469COG34697.0e-956298271+
cd02871GH18_chitinase_D-like6.0e-1257310305+
pfam00704Glyco_hydro_183.0e-2737298339+
cd02877GH18_hevamine_XipI_class_III7.0e-12737309280+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAA22266.103331130305basic class III chitinase OsChib3b [Oryza sativa Japonica Group]
GenBankEAZ14223.103531123296hypothetical protein OsJ_04148 [Oryza sativa Japonica Group]
RefSeqNP_001044872.103331130305Os01g0860500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001150942.1013111314hevamine-A [Zea mays]
RefSeqXP_002456672.1043113303hypothetical protein SORBIDRAFT_03g040600 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2hvm_A0333071269A Chain A, Crystal Structure Of Pichia Pastoris Phosphofructokinase In The T- State
PDB1llo_A0333071269A Chain A, Crystal Structure Of Pichia Pastoris Phosphofructokinase In The T- State
PDB1hvq_A0333071269A Chain A, Crystal Structures Of Hevamine, A Plant Defence Protein With Chitinase And Lysozyme Activity, And Its Complex With An Inhibitor
PDB1kr0_A0333071269A Chain A, Hevamine Mutant D125aY183F IN COMPLEX WITH TETRA-Nag
PDB1kr1_A0333071269A Chain A, Hevamine Mutant D125aE127A IN COMPLEX WITH TETRA-Nag
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV516422269373050
DT54755427162760
DR96518226252660
CN130449252372880
DR80080325452580