y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM5G858249_T01
FamilyCBM43
Protein PropertiesLength: 325 Molecular Weight: 33437.1 Isoelectric Point: 4.8888
ChromosomeChromosome/Scaffold: 5 Start: 14176514 End: 14178456
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM432353171.1e-32
  WCVARAGASDAELQADLDYACSQVGVDCSAIQPGGACFEPNTVRAHAAYAVNQLYQAAGRHPWNCDFRASATLTSDDPSYGAC
GH1712080
  MQNLRAAAAAAGGGAAGIRFSTVNTMGVMAQSDPPSTGAFHPDVAPQLQQILGFLSRTGAPFMINPYPWFAYQSDPRPDTLAFCLFQPNAGRVDGGSKIR
  YTNMFDAQLDAVKSALVRAGYGDVDVVVAETGWPTRGDAGEPGATAENARAYVSNLVAHLRSGAGTPLMPGKAVETYLFALYDEDLKPGPTSERSFGLYH
  TDLSMAYD
Full Sequence
Protein Sequence     Length: 325     Download
MQNLRAAAAA AGGGAAGIRF STVNTMGVMA QSDPPSTGAF HPDVAPQLQQ ILGFLSRTGA    60
PFMINPYPWF AYQSDPRPDT LAFCLFQPNA GRVDGGSKIR YTNMFDAQLD AVKSALVRAG    120
YGDVDVVVAE TGWPTRGDAG EPGATAENAR AYVSNLVAHL RSGAGTPLMP GKAVETYLFA    180
LYDEDLKPGP TSERSFGLYH TDLSMAYDAG LASSAAAGGR GGGGGGAAQP RGGGWCVARA    240
GASDAELQAD LDYACSQVGV DCSAIQPGGA CFEPNTVRAH AAYAVNQLYQ AAGRHPWNCD    300
FRASATLTSD DPSYGACVYT GGGQ*                                          360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53096.0e-712220284+
pfam07983X86.0e-2023530677+
smart00768X84.0e-3823531985+
pfam00332Glyco_hydro_171.0e-5718208191+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN26761.1013241323unknown [Zea mays]
GenBankEAY91326.101322139463hypothetical protein OsI_12942 [Oryza sativa Indica Group]
RefSeqNP_001141090.1013241324hypothetical protein LOC100273173 [Zea mays]
RefSeqNP_001148381.101324139461glucan endo-1,3-beta-glucosidase 7 [Zea mays]
RefSeqXP_002466692.101324147475hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3f55_D7.00005e-411212113316A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue
PDB3f55_C7.00005e-411212113316A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue
PDB3f55_B7.00005e-411212113316A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue
PDB3f55_A7.00005e-411212113316A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue
PDB3em5_D7.00005e-411212113316A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE163333275182920
EE152766267182840
EC876686245182620
EE180047245182620
CB672196256653170