| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM5G860761_T02 |
| Family | CBM43 |
| Protein Properties | Length: 117 Molecular Weight: 12430.2 Isoelectric Point: 8.5657 |
| Chromosome | Chromosome/Scaffold: 3 Start: 1295431 End: 1296371 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 33 | 113 | 5.8e-30 |
| WCVAKPSASNDILSLNLNYACSQVSCGVIQKGGPCYYPDNLVSRAAVAMNLYYAANGRHPWNCYFNNSALVVQSDPSYGSC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 117 Download |
| MARGGRLLIL SLGLVLLYFV SGSVAAAAAQ KTWCVAKPSA SNDILSLNLN YACSQVSCGV 60 IQKGGPCYYP DNLVSRAAVA MNLYYAANGR HPWNCYFNNS ALVVQSDPSY GSCTYY* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 6.0e-14 | 32 | 101 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-29 | 32 | 115 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACF83843.1 | 0 | 1 | 116 | 1 | 116 | unknown [Zea mays] |
| GenBank | ACG31507.1 | 0 | 1 | 116 | 1 | 116 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
| GenBank | ACG36169.1 | 0 | 12 | 116 | 5 | 109 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
| GenBank | ACG39487.1 | 0 | 18 | 116 | 23 | 122 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
| RefSeq | XP_002454863.1 | 0 | 18 | 116 | 24 | 123 | hypothetical protein SORBIDRAFT_03g000270 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 8e-25 | 29 | 115 | 9 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
