y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM5G860761_T02
FamilyCBM43
Protein PropertiesLength: 117 Molecular Weight: 12430.2 Isoelectric Point: 8.5657
ChromosomeChromosome/Scaffold: 3 Start: 1295431 End: 1296371
DescriptionCarbohydrate-binding X8 domain superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM43331135.8e-30
  WCVAKPSASNDILSLNLNYACSQVSCGVIQKGGPCYYPDNLVSRAAVAMNLYYAANGRHPWNCYFNNSALVVQSDPSYGSC
Full Sequence
Protein Sequence     Length: 117     Download
MARGGRLLIL SLGLVLLYFV SGSVAAAAAQ KTWCVAKPSA SNDILSLNLN YACSQVSCGV    60
IQKGGPCYYP DNLVSRAAVA MNLYYAANGR HPWNCYFNNS ALVVQSDPSY GSCTYY*       120
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X86.0e-143210176+
smart00768X82.0e-293211585+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF83843.1011161116unknown [Zea mays]
GenBankACG31507.1011161116glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
GenBankACG36169.10121165109glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
GenBankACG39487.101811623122glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
RefSeqXP_002454863.101811624123hypothetical protein SORBIDRAFT_03g000270 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jon_A8e-2529115996A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL39138193251170
FL38762492251160
FL39215693251170
FL41669093251170
CF63609893251170