CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM5G875864_T05
FamilyGT61
Protein PropertiesLength: 629 Molecular Weight: 67350 Isoelectric Point: 6.8567
ChromosomeChromosome/Scaffold: 8 Start: 10000181 End: 10003913
DescriptionGlycosyltransferase family 61 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT612374850
  CDVTSNRRIDWCELDGDVRVVGANASVTLVAPPGADNRTFRAESWRIKPYPRKADPNAMRFVRVLTVRSVASGSGEAACTDGGDDDVPALVFSDRGYTGN
  YFHAFTDVILPLFLTARRYAGEVRLLVADLQPWWVGKFLPVFRSISKYELVDLDRDPRVRCFRHVQVGLTSHADFSIDPRRAPNGYSMLDFTRFMRAAYG
  LPRGDVVAAAPARRPRLLVVARARTRRFVNTEEIVRGAEAVGFEAVVSE
Full Sequence
Protein Sequence     Length: 629     Download
MGMDAGGGKL PYSYAGQQDG GKLVKSVSRV EPRRFGLGLV AGFLLVTCAY FSTAKFDAIQ    60
IAMSKQTSRP VSSNAGGVGV GSLEVGGVVA AADTYNASRQ GLDLGKKGPG ATSMADEGSE    120
AEALEKDGGK ASSPSGPGVP AALLPPVSSE EAANSTLESG GLEDEELQVQ DAVASGSKRS    180
KDSAAAAAAT RSANVSSPSV VHSHHAILPA PAQRIPEVKQ ADSETTPARE REWKPLCDVT    240
SNRRIDWCEL DGDVRVVGAN ASVTLVAPPG ADNRTFRAES WRIKPYPRKA DPNAMRFVRV    300
LTVRSVASGS GEAACTDGGD DDVPALVFSD RGYTGNYFHA FTDVILPLFL TARRYAGEVR    360
LLVADLQPWW VGKFLPVFRS ISKYELVDLD RDPRVRCFRH VQVGLTSHAD FSIDPRRAPN    420
GYSMLDFTRF MRAAYGLPRG DVVAAAPARR PRLLVVARAR TRRFVNTEEI VRGAEAVGFE    480
AVVSEGTHEV APFAELANGC DAIMGVHGAG LTNMVFLPTG GVVIQVVPLG GLEFVAGYFR    540
GPSVDMGLRY LEYRIEPEES TLVDQYPRDH PIFTDPNGIK SKGWESLKDA YLDKQDVRLD    600
MERFRPTLQE AIAHLRKAKA KANGDGNN* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04577DUF5631.0e-12335528200+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG48121.1016281681glycosyltransferase [Zea mays]
GenBankACN27042.1016281681unknown [Zea mays]
RefSeqNP_001130385.1016281682hypothetical protein LOC100191481 [Zea mays]
RefSeqNP_001130824.1016281586hypothetical protein LOC100191928 [Zea mays]
RefSeqNP_001130987.1016281625hypothetical protein LOC100192092 [Zea mays]
Transmembrane Domains
StartEnd
3554
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV5353912891534410
DV5215372802064850
CD4329622682405070
CO4418092273695950
CO441809545716240.0002