| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01001735001 |
| Family | GH35 |
| Protein Properties | Length: 81 Molecular Weight: 9236.76 Isoelectric Point: 9.0524 |
| Chromosome | Chromosome/Scaffold: 10 Start: 644239 End: 644787 |
| Description | beta-galactosidase 10 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH35 | 1 | 70 | 2.7e-29 |
| MWLGLVKTTKEGGINVIETYVFWNGHELSPGNYYFGGWYDLLKFVKIVQQARTYLILRFGPFVVAEWNFG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 81 Download |
| MWLGLVKTTK EGGINVIETY VFWNGHELSP GNYYFGGWYD LLKFVKIVQQ ARTYLILRFG 60 PFVVAEWNFG WGSCLVALRA * 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG1874 | LacA | 0.0007 | 1 | 67 | 69 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam01301 | Glyco_hydro_35 | 2.0e-27 | 1 | 70 | 70 | + Glycosyl hydrolases family 35. | ||
| PLN03059 | PLN03059 | 3.0e-29 | 1 | 70 | 70 | + beta-galactosidase; Provisional | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI16777.1 | 0 | 1 | 80 | 1 | 80 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI17318.1 | 3e-33 | 1 | 70 | 1 | 70 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI21589.1 | 2e-32 | 1 | 70 | 1 | 70 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI21600.1 | 4e-35 | 1 | 70 | 53 | 122 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI25664.1 | 1e-37 | 1 | 70 | 1 | 70 | unnamed protein product [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3d3a_A | 0.000000000003 | 2 | 70 | 39 | 107 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8d_B | 0.000000000004 | 13 | 70 | 45 | 102 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8d_A | 0.000000000004 | 13 | 70 | 45 | 102 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8c_B | 0.000000000004 | 13 | 70 | 45 | 102 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| PDB | 4e8c_A | 0.000000000004 | 13 | 70 | 45 | 102 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| lactose degradation III | BETAGALACTOSID-RXN | EC-3.2.1.23 | β-galactosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EE063851 | 70 | 1 | 70 | 4e-36 |
| CK747743 | 70 | 1 | 70 | 4e-33 |
| FY921632 | 70 | 1 | 70 | 2e-32 |
| DW046801 | 70 | 1 | 70 | 3e-32 |
| EL347269 | 70 | 1 | 70 | 3e-32 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Fragaria vesca | mrna24183.1-v1.0-hybrid | ||||
| Vitis vinifera | GSVIVT01022324001 | GSVIVT01012605001 | GSVIVT01003541001 | GSVIVT01003629001 | |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |