CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01002028001
FamilyGT13
Protein PropertiesLength: 440 Molecular Weight: 51188.7 Isoelectric Point: 7.1005
ChromosomeChromosome/Scaffold: Start: 32355729 End: 32373409
Descriptionalpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, putative
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT13234330
  QLRLFATQSEYAERIAAAVEAENQCTSQMRSLIDQISMQQGRIVALEEQKKLQDLECGQLRTLVQELERKGLQRLIDKVQEPVAAVVIMACNRADYLERT
  IKSVLKYQSSVALKYPLFVSQDGADPSVRSKALSYDQLAYMQHLDNEPVKTERPGELIAYYKIARHYKWALDELFYKNNFSRVIILEDDMEIAPDFFDYF
  EAAAALLDNDKSIMAVSSWNDNGQKQFVHDPYTLYRSDFFPGLGWMLSKSIWDELSPKWPKAYPLWLKENHKGRQFIRPEVCRTYNFGEHGSSFGQFFKQ
  YLEPIKLNDVRVDWKSIDLSFLREDKYPRHFADMVKNAKPVYGADVVLKAYNIDGDVRIQYRDQADFERIARQFGIFEEWKDGIPRTAYKGVVVFRYQTP
  RRIFLVASDSL
Full Sequence
Protein Sequence     Length: 440     Download
MPKFLCDVRV LLVVAAIAFI YLQLRLFATQ SEYAERIAAA VEAENQCTSQ MRSLIDQISM    60
QQGRIVALEE QKKLQDLECG QLRTLVQELE RKGLQRLIDK VQEPVAAVVI MACNRADYLE    120
RTIKSVLKYQ SSVALKYPLF VSQDGADPSV RSKALSYDQL AYMQHLDNEP VKTERPGELI    180
AYYKIARHYK WALDELFYKN NFSRVIILED DMEIAPDFFD YFEAAAALLD NDKSIMAVSS    240
WNDNGQKQFV HDPYTLYRSD FFPGLGWMLS KSIWDELSPK WPKAYPLWLK ENHKGRQFIR    300
PEVCRTYNFG EHGSSFGQFF KQYLEPIKLN DVRVDWKSID LSFLREDKYP RHFADMVKNA    360
KPVYGADVVL KAYNIDGDVR IQYRDQADFE RIARQFGIFE EWKDGIPRTA YKGVVVFRYQ    420
TPRRIFLVAS DSLRWLGID* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13641Glyco_tranf_2_30.007107219117+
cd00761Glyco_tranf_GTA_type0.004108241134+
cd02514GT13_GLCNAC-TI8.0e-161105432338+
pfam03071GNT-I015439436+
Gene Ontology
GO TermDescription
GO:0000139Golgi membrane
GO:0003827alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
GO:0006487protein N-linked glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAC80697.1034395444N-acetylglucosaminyltransferase I [Solanum tuberosum]
EMBLCAC80702.1034395444N-acetylglucosaminyltransferase I [Nicotiana tabacum]
EMBLCBI29533.1014391439unnamed protein product [Vitis vinifera]
RefSeqNP_195537.2014381441CGL1 (COMPLEX GLYCAN LESS 1); alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase/ protein N-acetylglucosaminyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002313578.1014381438predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1foa_A01054398344A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB1fo9_A01054398344A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2apc_A01054392338A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2am5_A01054392338A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2am4_A01054392338A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
Transmembrane Domains
StartEnd
527
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EH7311532911524390
GO802527325293470
ES8416563041284260
GO802714315293370
GO865783324153330
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00911.3Aquca_007_00911.4Aquca_007_00911.2Aquca_007_00911.1Aquca_007_00911.5
Arabidopsis lyrata912565490588
Arabidopsis thalianaAT4G38240.1AT4G38240.2AT4G38240.3
Brachypodium distachyonBradi3g60820.3Bradi3g60820.1Bradi3g60820.2
Brassica rapaBra033557
Carica papayaevm.TU.contig_28580.1.22.235evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.22.235
Capsella rubellaCarubv10007540m
Citrus clementinaCiclev10028418m
Citrus sinensisorange1.1g019888morange1.1g012912morange1.1g012941m
Cucumis sativusCucsa.099720.1Cucsa.099720.2
Eucalyptus grandisEucgr.L00584.1Eucgr.L00583.1Eucgr.H04987.1Eucgr.H04987.2Eucgr.H04989.3
Eucgr.H04989.2Eucgr.H04989.4Eucgr.H04989.1
Fragaria vescamrna17328.1-v1.0-hybrid
Glycine maxGlyma04g00200.1Glyma06g00230.1
Gossypium raimondiiGorai.008G014000.2Gorai.008G014000.3Gorai.008G014000.1
Linum usitatissimumLus10022994Lus10001389
Malus domesticaMDP0000173465.283.435MDP0000170967.230.351MDP0000170967.22.209MDP0000170967.22.209MDP0000173465.283.435
MDP0000173465.22.268MDP0000173465.22.268MDP0000170967.230.351
Manihot esculentacassava4.1_024783m
Medicago truncatulaMedtr3g118520.1Medtr3g118520.2Medtr3g118520.3
Mimulus guttatusmgv1a006517mmgv1a006750m
Oryza sativaLOC_Os02g58590.1.304.426LOC_Os02g58590.1.304.426LOC_Os02g58590.1.22.283LOC_Os02g58590.1.22.283
Panicum virgatumPavirv00053907mPavirv00020030m
Physcomitrella patensPp1s100_54V6.1Pp1s246_61V6.1
Phaseolus vulgarisPhvul.009G115600.1
Picea abiesMA_901813g0010
Populus trichocarpaPotri.009G168000.2Potri.009G168000.1Potri.009G168000.4Potri.004G206900.3Potri.004G206900.1
Potri.004G206900.2Potri.009G168000.3
Prunus persicappa006221m
Ricinus communis29675.m000398.22.23129675.m000398.232.34829675.m000398.232.34829675.m000398.22.231
Setaria italicaSi006441mSi006440m
Selaginella moellendorffii268301
Sorghum bicolorSb08g003660.1
Thellungiella halophilaThhalv10025211mThhalv10025208mThhalv10025250m
Vitis viniferaGSVIVT01002907001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny