| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01002907001 |
| Family | GT13 |
| Protein Properties | Length: 96 Molecular Weight: 11206.7 Isoelectric Point: 4.5114 |
| Chromosome | Chromosome/Scaffold: Start: 37193707 End: 37195699 |
| Description | alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, putative |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT13 | 1 | 95 | 1.4013e-45 |
| MQHLDNEPVKTERPGELIAYYKIARHYKWALDELFYKNNFSRVIILEDDMEIAPDFFDYFEAAAALLDNDKSIMAVSSWNDNGQKQFVHDPCKLF | |||
| Full Sequence |
|---|
| Protein Sequence Length: 96 Download |
| MQHLDNEPVK TERPGELIAY YKIARHYKWA LDELFYKNNF SRVIILEDDM EIAPDFFDYF 60 EAAAALLDND KSIMAVSSWN DNGQKQFVHD PCKLF* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd02514 | GT13_GLCNAC-TI | 2.0e-45 | 1 | 90 | 90 | + GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GLCNAC-T I , GNT-I) transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide, an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus. The catalytic domain is located at the C-terminus. These proteins are members of the glycosy transferase family 13. | ||
| pfam03071 | GNT-I | 5.0e-48 | 1 | 90 | 92 | + GNT-I family. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GNT-I, GLCNAC-T I) EC:2.4.1.101 transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide. This is an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localised to the Golgi apparatus, and is probably distributed in all tissues. The catalytic domain is located at the C-terminus. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0000139 | Golgi membrane |
| GO:0003827 | alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity |
| GO:0006487 | protein N-linked glycosylation |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI23557.1 | 0 | 1 | 95 | 1 | 95 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI29533.1 | 0 | 1 | 95 | 163 | 257 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002266012.1 | 0 | 1 | 84 | 163 | 246 | PREDICTED: hypothetical protein, partial [Vitis vinifera] |
| RefSeq | XP_002313578.1 | 0 | 1 | 95 | 161 | 255 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002328133.1 | 0 | 1 | 95 | 164 | 258 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1fo8_A | 2e-23 | 19 | 88 | 79 | 148 | A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I |
| PDB | 2apc_A | 2e-23 | 19 | 88 | 78 | 147 | A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I |
| PDB | 2am5_A | 2e-23 | 19 | 88 | 78 | 147 | A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I |
| PDB | 2am4_A | 2e-23 | 19 | 88 | 78 | 147 | A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I |
| PDB | 2am3_A | 2e-23 | 19 | 88 | 78 | 147 | A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I In Complex With Udp-Glucose |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DT501093 | 95 | 1 | 95 | 0 |
| FS325923 | 91 | 1 | 91 | 0 |
| BU837218 | 95 | 1 | 95 | 0 |
| FC861780 | 94 | 1 | 94 | 0 |
| FD502844 | 95 | 1 | 95 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |