| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01003541001 |
| Family | GH35 |
| Protein Properties | Length: 114 Molecular Weight: 13537.9 Isoelectric Point: 7.0867 |
| Chromosome | Chromosome/Scaffold: 16 Start: 226257 End: 227252 |
| Description | beta-galactosidase 10 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH35 | 9 | 104 | 4.6e-34 |
| INVIETYVFWIGHELSPGNYYFGGWYDLLKFVKIVQQDGMWLILHIGPFVATEWNFSGIPVWLHYVLGTVFWTNSEPFKYHMQKFMTLIVNIMKKR | |||
| Full Sequence |
|---|
| Protein Sequence Length: 114 Download |
| MAESLFDWIN VIETYVFWIG HELSPGNYYF GGWYDLLKFV KIVQQDGMWL ILHIGPFVAT 60 EWNFSGIPVW LHYVLGTVFW TNSEPFKYHM QKFMTLIVNI MKKRSFLHLK EVL* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam01301 | Glyco_hydro_35 | 8.0e-35 | 9 | 104 | 96 | + Glycosyl hydrolases family 35. | ||
| PLN03059 | PLN03059 | 1.0e-35 | 9 | 102 | 94 | + beta-galactosidase; Provisional | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAF70823.1 | 9.80909e-45 | 9 | 103 | 89 | 183 | AF154422_1 beta-galactosidase [Solanum lycopersicum] |
| EMBL | CBI18695.1 | 0 | 1 | 113 | 1 | 113 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI21600.1 | 0 | 9 | 106 | 66 | 163 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI25664.1 | 0 | 9 | 113 | 14 | 118 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI33129.1 | 0 | 8 | 105 | 68 | 165 | unnamed protein product [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4e8d_B | 0.000000000002 | 10 | 71 | 47 | 108 | A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A |
| PDB | 4e8d_A | 0.000000000002 | 10 | 71 | 47 | 108 | A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A |
| PDB | 4e8c_B | 0.000000000002 | 10 | 71 | 47 | 108 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| PDB | 4e8c_A | 0.000000000002 | 10 | 71 | 47 | 108 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| PDB | 3d3a_A | 0.000000000006 | 9 | 111 | 51 | 150 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| lactose degradation III | BETAGALACTOSID-RXN | EC-3.2.1.23 | β-galactosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EE063851 | 98 | 9 | 106 | 0 |
| FY921632 | 97 | 9 | 105 | 0 |
| EY152713 | 106 | 9 | 114 | 0 |
| GT657320 | 98 | 9 | 106 | 0 |
| FS076049 | 98 | 9 | 106 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Fragaria vesca | mrna24183.1-v1.0-hybrid | ||||
| Vitis vinifera | GSVIVT01022324001 | GSVIVT01012605001 | GSVIVT01001735001 | GSVIVT01003629001 | |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |