y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01005754001
FamilyGT77
Protein PropertiesLength: 678 Molecular Weight: 77891.7 Isoelectric Point: 9.017
ChromosomeChromosome/Scaffold: Start: 21842574 End: 21850017
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT773705900
  ITNFVVCALDHDVYQFSLLQGLPVFEDPLAPSDISFDDCHFGTKCFQRVTKSKSRLVLQILKLGYNVLMSDVDVYWFKNPLPLLYSFGPAILVAQSDEYK
  ETGPINLPRRLNSGFYFARSDDTTIAGMEKVVKHAASSNLSEQPSFYDSLCGEGGSYRLGDNRCLEPETNLTVHFLDRNLFPNGAYQNLWEKKKWKSVCS
  KKDCFILHNNWISGRRKKLQR
Full Sequence
Protein Sequence     Length: 678     Download
MKATCFILAS FDHKKSLPSL EDHIKMPKQL HQGFANLTSP KITIFSAPDP LNAPPGPRQV    60
LAVRSWLALS PYITVVLFSR DPSVVVFARA FGSRVSVEPN IDFTFLGTPF FHSMVARSWA    120
STSDISVLTD FETILLPDFI STLSYAHKLD YDWLLFAPLR SVFYFPFRLD EAGKHWLRKD    180
GKRIRTQKMQ EFLAQSWQWN CHEGRMLMAW NNRGLPLHTG VLPPFLYGKG LHNHWVINEA    240
LSSELRFIFD ASWTITSFYL KDLDQWSDRL VEVNYSNLSS LRLWKRRILH PRREKKTMEC    300
IHAITSLERN MDCSVKHQLD FSSPLYLPFS LESLLSVIAD KNKTIVLAVA GYSYKDMLMS    360
WVCRLRSLLI TNFVVCALDH DVYQFSLLQG LPVFEDPLAP SDISFDDCHF GTKCFQRVTK    420
SKSRLVLQIL KLGYNVLMSD VDVYWFKNPL PLLYSFGPAI LVAQSDEYKE TGPINLPRRL    480
NSGFYFARSD DTTIAGMEKV VKHAASSNLS EQPSFYDSLC GEGGSYRLGD NRCLEPETNL    540
TVHFLDRNLF PNGAYQNLWE KKKWKSVCSK KDCFILHNNW ISGRRKKLQR QVLSGLWGYD    600
ISSRMCLQSW QKTKSTIGKL ILFPESEYND FNLQEIILEQ GNINIQQIIP EKYGDHVGAR    660
KHEHSTNNVG RIWGVSK*                                                  720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans2.0e-52368591225+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN65937.101146161543hypothetical protein [Vitis vinifera]
EMBLCBI18645.1016771677unnamed protein product [Vitis vinifera]
RefSeqNP_177220.201146071537unknown protein [Arabidopsis thaliana]
RefSeqXP_002271910.101146271569PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312675.101146081551predicted protein [Populus trichocarpa]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL3424482553586120
EX1364522363245590
EL3544682843246070
EH6740232532955470
GO9564462323856160
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_094_00019.1Aquca_094_00019.2Aquca_094_00019.3Aquca_094_00019.4
Arabidopsis lyrata476193
Arabidopsis thalianaAT1G70630.1
Brachypodium distachyonBradi2g19997.1
Brassica rapaBra016198
Carica papayaevm.model.supercontig_33.19
Capsella rubellaCarubv10019952mCarubv10020113m
Citrus clementinaCiclev10033870m
Citrus sinensisorange1.1g043225m
Cucumis sativusCucsa.286480.1
Eucalyptus grandisEucgr.B03287.1
Glycine maxGlyma18g20856.1Glyma08g38866.1
Gossypium raimondiiGorai.005G178600.1Gorai.005G178600.2
Linum usitatissimumLus10036860Lus10006212
Malus domesticaMDP0000300726
Manihot esculentacassava4.1_024537m
Medicago truncatulaMedtr8g069400.1
Mimulus guttatusmgv1a025056mmgv1a022943m
Oryza sativaLOC_Os05g43810.1
Panicum virgatumPavirv00043566mPavirv00008500m
Physcomitrella patensPp1s151_80V6.1Pp1s21_134V6.1
Phaseolus vulgarisPhvul.003G065100.1
Picea abiesMA_10426353g0010
Populus trichocarpaPotri.008G186800.1
Prunus persicappa019665m
Ricinus communis27504.m000645
Selaginella moellendorffii76356
Sorghum bicolorSb09g025390.1
Thellungiella halophilaThhalv10018343m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny