| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01006154001 |
| Family | GH32 |
| Protein Properties | Length: 170 Molecular Weight: 19460 Isoelectric Point: 4.2973 |
| Chromosome | Chromosome/Scaffold: Start: 42193101 End: 42195168 |
| Description | Glycosyl hydrolases family 32 protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH32 | 10 | 128 | 0 |
| HFQPEKNWMNDPNGPMFYGGWYHFFYQYNPDAAVWGNIVWGHAVSKDLIEWLHLPLAMVADQWYDTNGVWTGSATLLSDGQVIMLYTGATNESVQVQNLA YPADLSDPLLVDWVKYPVN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 170 Download |
| MLTWQRTGYH FQPEKNWMND PNGPMFYGGW YHFFYQYNPD AAVWGNIVWG HAVSKDLIEW 60 LHLPLAMVAD QWYDTNGVWT GSATLLSDGQ VIMLYTGATN ESVQVQNLAY PADLSDPLLV 120 DWVKYPVNKT GISLVYNTED FKKYELIEGV LHAVPGTGMW ECVDLYPVSL 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR01322 | scrB_fam | 2.0e-30 | 6 | 168 | 204 | + sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
| COG1621 | SacC | 7.0e-40 | 6 | 168 | 204 | + Beta-fructosidases (levanase/invertase) [Carbohydrate transport and metabolism] | ||
| cd08996 | GH32_B_Fructosidase | 3.0e-48 | 16 | 168 | 192 | + Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller. | ||
| smart00640 | Glyco_32 | 5.0e-74 | 10 | 169 | 201 | + Glycosyl hydrolases family 32. | ||
| pfam00251 | Glyco_hydro_32N | 4.0e-76 | 10 | 169 | 199 | + Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAB47172.1 | 0 | 1 | 170 | 128 | 334 | vacuolar invertase 2, GIN2 [Vitis vinifera=grape berries, Sultana, berries, Peptide, 664 aa] |
| GenBank | AAM52062.1 | 0 | 1 | 169 | 107 | 312 | vacuolar acid invertase PsI-1 [Pisum sativum] |
| EMBL | CBI14850.1 | 0 | 1 | 170 | 1 | 170 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002272774.1 | 0 | 1 | 170 | 68 | 274 | PREDICTED: similar to vacuolar invertase 2, GIN2 isoform 1 [Vitis vinifera] |
| RefSeq | XP_002272809.1 | 0 | 22 | 170 | 2 | 187 | PREDICTED: similar to vacuolar invertase 2, GIN2 isoform 2 [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ugh_B | 0 | 2 | 169 | 15 | 219 | B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules |
| PDB | 3ugh_A | 0 | 2 | 169 | 15 | 219 | B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules |
| PDB | 3ugg_B | 0 | 2 | 169 | 15 | 219 | B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules |
| PDB | 3ugg_A | 0 | 2 | 169 | 15 | 219 | B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules |
| PDB | 3ugf_B | 0 | 2 | 169 | 15 | 219 | A Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| sucrose degradation III | RXN-1461 | EC-3.2.1.26 | β-fructofuranosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| FG890042 | 206 | 1 | 169 | 0 |
| EL446383 | 206 | 1 | 169 | 0 |
| DY937590 | 206 | 1 | 169 | 0 |
| DY937769 | 206 | 1 | 169 | 0 |
| EE637534 | 206 | 1 | 169 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
