y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01006709001
FamilyGH35
Protein PropertiesLength: 315 Molecular Weight: 35985.5 Isoelectric Point: 9.0493
ChromosomeChromosome/Scaffold: Start: 27685990 End: 27689869
Descriptionbeta-galactosidase 8
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH351673120
  LVIDGKRRVLQSGSIHYPRSMPEVWPEIIRKSKEGGLDVIETYVFWNNHEPVRGEYYFEGRFDLVRFVKTVQEAGLLVHLRIGPYACAEWNYGGFPVWLH
  FIPGIQFRTTNDLFKNEMKRFLAKIVSLMKEANLFAPQGGPIILAQ
Full Sequence
Protein Sequence     Length: 315     Download
MGSVWAQVHY DNEPGRNLID KSHTLNLNFR QDSGCAKQGK EPEPFCFCVC PFPPSFSNTS    60
LRSTIIAHIP SLANIRSTSF FPLKISNRFH SFVHNTQTKQ NYTPHLPHTT HTLSGIKLYQ    120
SLQHYCNLGI GFFPIMGNKD LVLLVLIAVC VFEGCYCKTV TYDHRALVID GKRRVLQSGS    180
IHYPRSMPEV WPEIIRKSKE GGLDVIETYV FWNNHEPVRG EYYFEGRFDL VRFVKTVQEA    240
GLLVHLRIGP YACAEWNYGG FPVWLHFIPG IQFRTTNDLF KNEMKRFLAK IVSLMKEANL    300
FAPQGGPIIL AQKTS                                                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_424.0e-618326585+
COG1874LacA1.0e-17160266109+
pfam01301Glyco_hydro_353.0e-79166312147+
PLN03059PLN030595.0e-82137312179+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ86220.101413128178unknown [Medicago truncatula]
EMBLCBI23471.1013151315unnamed protein product [Vitis vinifera]
RefSeqXP_002268994.101362831148PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002317239.101353125188predicted protein [Populus trichocarpa]
RefSeqXP_002521428.101363121182beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A4e-251593127158A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D5e-2516031211161A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C5e-2516031211161A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_B5e-2516031211161A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_A5e-2516031211161A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT0042521501292780
FS0930281771363120
BP9060371561382930
DR5340431931293120
CO0762431801333120
Orthologous Group
SpeciesID
Brassica rapaBra008306
Carica papayaevm.TU.contig_28540.1evm.model.supercontig_28.7
Cucumis sativusCucsa.155220.1Cucsa.374340.1
Linum usitatissimumLus10025108.29.144Lus10005070.37.184Lus10005070.37.184Lus10025110.33.156Lus10025110.33.156
Lus10025108.29.144Lus10025108.29.144Lus10020877.21.135Lus10020877.21.135
Malus domesticaMDP0000206653MDP0000275455
Phaseolus vulgarisPhvul.009G225100.1.36.150Phvul.009G225100.1.36.150
Picea abiesMA_10430283g0010MA_19375g0010MA_329922g0010
Ricinus communis59437.m0000529739.m003719.32.14629739.m003719.32.146
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny