y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01008995001
FamilyGH5
Protein PropertiesLength: 509 Molecular Weight: 56704.2 Isoelectric Point: 6.5228
ChromosomeChromosome/Scaffold: 18 Start: 4130710 End: 4134329
Description
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52214968.5e-41
  MKEHWSTFIVEDDFKFISENGLNAVRIPVGWWIACDPTPPSPFVGGSLYALDNAFTWARKYKVNVIIDLHAAPGSQNGWEHSASRDGSQEWGKTDQNIQK
  TVAVIEFLTARYANNPSLYAVELINEPLSPGATLEMVTKYYRAGYEAVRKHSLTAYVVMSNRLGPADSRELFPLTSGLSRAVIDVHYYNLFEDMFDHMTV
  QQNIDFVNTNRSAQLGRVTTSNGPLTFVGEWVVEWKVEGATKKDYQRFAKAQLKVFGRATFGWAYWTLKNVKNHWS
Full Sequence
Protein Sequence     Length: 509     Download
MTGTSTTKLL SILCAAFSCI LSLSYGRVNP NFQVKAVNLG GWLVTEGWIK PSLFDDIPNK    60
DFLDGTELQF KSVTIGKYLC AETGGGTIIV VNRTAASGWE TFRLWRINET AFHFRVFNKQ    120
FMGLDTAGNG IDIVAVSNTP GGSETFQIVK NPNDSKRVRI KAPNGFFLQA KTEELVTADY    180
AGDGGWGDDD PTVFVMTVNV ALEGEFQVTN GYGPDKAPQV MKEHWSTFIV EDDFKFISEN    240
GLNAVRIPVG WWIACDPTPP SPFVGGSLYA LDNAFTWARK YKVNVIIDLH AAPGSQNGWE    300
HSASRDGSQE WGKTDQNIQK TVAVIEFLTA RYANNPSLYA VELINEPLSP GATLEMVTKY    360
YRAGYEAVRK HSLTAYVVMS NRLGPADSRE LFPLTSGLSR AVIDVHYYNL FEDMFDHMTV    420
QQNIDFVNTN RSAQLGRVTT SNGPLTFVGE WVVEWKVEGA TKKDYQRFAK AQLKVFGRAT    480
FGWAYWTLKN VKNHWSLEWM INNGYIKL*                                      540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00257Fascin4.0e-770179110+
pfam00150Cellulase2.0e-10224408195+
COG2730BglC3.0e-28199432239+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI18831.102850829505unnamed protein product [Vitis vinifera]
EMBLCBI33033.102850829505unnamed protein product [Vitis vinifera]
RefSeqNP_001064458.101950816508Os10g0370500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002285806.1015081508PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002513884.1015081506conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3n9k_A4e-3420550450381A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB1eqp_A6e-3420550445376A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB2pb1_A1e-3320550451382A Chain A, Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Unhydrolysed And Covalently Linked 2,4-dinitrophenyl-2-deoxy-2- Fluoro-b-d-glucopyranoside At 1.9 A
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE076947276643390
DC8989053811285080
DV2199442322134440
EC9270752482625090
JG5647013031924940
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3
Gorai.003G044000.2Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)