CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01009775001
FamilyGT4
Protein PropertiesLength: 464 Molecular Weight: 52013.5 Isoelectric Point: 10.1201
ChromosomeChromosome/Scaffold: 18 Start: 11175010 End: 11180097
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42604277.8e-24
  NEDLLFAVINSVSRGKGQDLFLRSFYQSLQLIKGRKLQVPSIHAVIVGSDMNAQTKFETELRNFVVENKIQDQVHFINKTLTVAPYLASIDVLVQNSQAR
  GECFGRITIEAMAFQLPVLGTAAGGTTEIVVNGTTGLLHNVGKEGVKPLANNIVKLATNVERRLTMGK
Full Sequence
Protein Sequence     Length: 464     Download
MAKQSTSWLT FHKRWPLLLV ALLSTSTVIV LLIRAASDSC NTNSNTRIQV TSQVETPSNP    60
LRFMKSKLVL LVSHELSLSG GPLLLMELAF LLRGVGAEVV WLTIQKPTDS DEVIYSLEHR    120
MLDRGVKVFP AKGQEAIDTA LKADLVVLNT AVAGKWLDSV VKENVPRILP KVLWWIHEMR    180
GHYFKLEYVK HLPYVAGAMI DSHTTAEYWK NRTRERLGIK MPETYVVHLG NSKELMEIAE    240
NNVAKRVLRE HVRESLGVRN EDLLFAVINS VSRGKGQDLF LRSFYQSLQL IKGRKLQVPS    300
IHAVIVGSDM NAQTKFETEL RNFVVENKIQ DQVHFINKTL TVAPYLASID VLVQNSQARG    360
ECFGRITIEA MAFQLPVLGT AAGGTTEIVV NGTTGLLHNV GKEGVKPLAN NIVKLATNVE    420
RRLTMGKRGY ERVKERFLEH HMSERIASVL KEVLKKAENH AFS*                     480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00072hydrog_prot6.0e-17275435162+
cd03798GT1_wlbH_like2.0e-20253453205+
COG0438RfaG1.0e-20161456322+
cd03808GT1_cap1E_like1.0e-22275446173+
cd03801GT1_YqgM_like5.0e-3180451388+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN73426.1014541470hypothetical protein [Vitis vinifera]
EMBLCBI19755.1014631463unnamed protein product [Vitis vinifera]
RefSeqXP_002281084.1014631479PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002327680.101046318481predicted protein [Populus trichocarpa]
RefSeqXP_002510442.1014581476glycosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jjm_L0.000000000004329459265391A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_K0.000000000004329459265391A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_J0.000000000004329459265391A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_I0.000000000004329459265391A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_H0.000000000004329459265391A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Transmembrane Domains
StartEnd
1537
6890
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7808963281304570
DY290388338984350
HO8056393241344570
ES8320743341164450
FC888556284983810
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00577.1Aquca_001_00590.2Aquca_001_00590.1
Arabidopsis lyrata889408316473897892474368
Arabidopsis thalianaAT1G19710.1AT1G75420.1AT3G15940.2AT3G15940.1AT1G52420.1
Brachypodium distachyonBradi2g09620.1
Brassica rapaBra025759Bra027200Bra030384
Carica papayaevm.model.supercontig_99.5evm.model.supercontig_253.2
Capsella rubellaCarubv10020237mCarubv10011399mCarubv10013095m
Citrus clementinaCiclev10025538mCiclev10001031mCiclev10024994m
Citrus sinensisorange1.1g023290morange1.1g017123morange1.1g017085morange1.1g012132morange1.1g011954m
orange1.1g004942morange1.1g004760m
Cucumis sativusCucsa.105340.1Cucsa.300870.1
Eucalyptus grandisEucgr.F01601.1Eucgr.F03009.1Eucgr.J03011.1
Fragaria vescamrna15198.1-v1.0-hybridmrna14930.1-v1.0-hybridmrna05979.1-v1.0-hybrid
Glycine maxGlyma04g03170.1Glyma06g03220.1Glyma15g01640.6Glyma15g01640.5Glyma15g01640.4
Glyma15g01640.3Glyma08g22160.2Glyma07g03870.1Glyma13g43720.1
Gossypium raimondiiGorai.009G198800.1Gorai.003G012600.2Gorai.003G012600.1Gorai.007G199800.4Gorai.007G199800.3
Gorai.007G199800.1Gorai.009G132600.4Gorai.009G132600.3Gorai.009G132600.2Gorai.009G132600.1
Gorai.002G058400.1Gorai.011G077500.1
Linum usitatissimumLus10041786Lus10028338Lus10024281Lus10011469Lus10037523
Malus domesticaMDP0000210114MDP0000312093MDP0000064350MDP0000204168
Manihot esculentacassava4.1_006962mcassava4.1_006727mcassava4.1_002537m
Medicago truncatulaMedtr4g069840.1
Mimulus guttatusmgv1a005641mmgv1a002407m
Oryza sativaLOC_Os01g15780.1
Panicum virgatumPavirv00028369m
Physcomitrella patensPp1s24_249V6.3
Phaseolus vulgarisPhvul.009G060600.1Phvul.010G151400.1Phvul.005G172300.2Phvul.005G172300.1
Picea abiesMA_159042g1120
Populus trichocarpaPotri.005G118800.1Potri.002G031300.1Potri.001G179000.1Potri.001G179000.5
Prunus persicappa005334mppa005118mppa002059m
Ricinus communis30170.m01409429872.m00052635599.m00001450675.m000024
Setaria italicaSi002128m
Selaginella moellendorffii10326098243
Sorghum bicolorSb03g010200.1
Thellungiella halophilaThhalv10007567mThhalv10007509mThhalv10018489mThhalv10020188mThhalv10011288m
Thhalv10011286m
Vitis viniferaGSVIVT01018875001GSVIVT01017132001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)