| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01010303001 |
| Family | CE10 |
| Protein Properties | Length: 178 Molecular Weight: 19126.8 Isoelectric Point: 9.2804 |
| Chromosome | Chromosome/Scaffold: 1 Start: 19226855 End: 19229542 |
| Description | carboxyesterase 16 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE10 | 22 | 152 | 1.3e-33 |
| SGRRLPVLLQFHGGGFVSGSNNSVANDVFCRRIAKLCDVVVVAVGYRLAPENRYPAAFEDGVRALHWVGKQANLADWSRSQWKVGRDTMNDNFGASMVEP WLAAHGDPSRCVLLGVSCGANIADYVARRSV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 178 Download |
| MPTVAVKLDD SYGGYSPSAG RSGRRLPVLL QFHGGGFVSG SNNSVANDVF CRRIAKLCDV 60 VVVAVGYRLA PENRYPAAFE DGVRALHWVG KQANLADWSR SQWKVGRDTM NDNFGASMVE 120 PWLAAHGDPS RCVLLGVSCG ANIADYVARR SVEAGKLLDP VKLCACLHGN SSYLRKK* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00312 | Esterase_lipase | 0.006 | 15 | 141 | 136 | + Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate. | ||
| PRK10162 | PRK10162 | 0.0005 | 48 | 94 | 47 | + acetyl esterase; Provisional | ||
| pfam00135 | COesterase | 8.0e-5 | 15 | 146 | 147 | + Carboxylesterase family. | ||
| COG0657 | Aes | 3.0e-12 | 15 | 158 | 144 | + Esterase/lipase [Lipid metabolism] | ||
| pfam07859 | Abhydrolase_3 | 8.0e-24 | 48 | 158 | 111 | + alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016787 | hydrolase activity |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI27528.1 | 0 | 1 | 177 | 1 | 177 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_568298.1 | 0 | 10 | 165 | 135 | 301 | AtCXE16 (Arabidopsis thaliana carboxyesterase 16); hydrolase |
| RefSeq | XP_002272331.1 | 0 | 4 | 167 | 90 | 253 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002311735.1 | 0 | 12 | 165 | 93 | 243 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002515006.1 | 0 | 12 | 165 | 97 | 247 | catalytic, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ed1_F | 4e-19 | 26 | 173 | 112 | 227 | A Chain A, Glutathionylspermidine SynthetaseAMIDASE C59A COMPLEX WITH ADP AND Gsp |
| PDB | 3ed1_E | 4e-19 | 26 | 173 | 112 | 227 | A Chain A, Glutathionylspermidine SynthetaseAMIDASE C59A COMPLEX WITH ADP AND Gsp |
| PDB | 3ed1_D | 4e-19 | 26 | 173 | 112 | 227 | A Chain A, Glutathionylspermidine SynthetaseAMIDASE C59A COMPLEX WITH ADP AND Gsp |
| PDB | 3ed1_C | 4e-19 | 26 | 173 | 112 | 227 | A Chain A, Glutathionylspermidine SynthetaseAMIDASE C59A COMPLEX WITH ADP AND Gsp |
| PDB | 3ed1_B | 4e-19 | 26 | 173 | 112 | 227 | A Chain A, Glutathionylspermidine SynthetaseAMIDASE C59A COMPLEX WITH ADP AND Gsp |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EH734402 | 161 | 12 | 165 | 0 |
| CK717663 | 164 | 12 | 165 | 0 |
| DT480110 | 154 | 12 | 165 | 0 |
| ES789976 | 170 | 12 | 165 | 0 |
| DV121594 | 160 | 10 | 165 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |