| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01011699001 |
| Family | CE8 |
| Protein Properties | Length: 148 Molecular Weight: 16135.8 Isoelectric Point: 7.0383 |
| Chromosome | Chromosome/Scaffold: 1 Start: 5011824 End: 5018047 |
| Description | Plant invertase/pectin methylesterase inhibitor superfamily |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 1 | 146 | 0 |
| MIIGDGKDATIVTGNKNVQDGSTTFRSATFAVSGHGFIARDMTFENTAGPEKHQAVALRSSSDGSVFYGCSFKGYQDTLYVHTQRQFYRSCDVYGTVDFI FGDAVAVLQNCNIYVRRPMSNQANVITAQGRSDQNENTGISIHNSH | |||
| Full Sequence |
|---|
| Protein Sequence Length: 148 Download |
| MIIGDGKDAT IVTGNKNVQD GSTTFRSATF AVSGHGFIAR DMTFENTAGP EKHQAVALRS 60 SSDGSVFYGC SFKGYQDTLY VHTQRQFYRS CDVYGTVDFI FGDAVAVLQN CNIYVRRPMS 120 NQANVITAQG RSDQNENTGI SIHNSHY* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02314 | PLN02314 | 3.0e-78 | 1 | 142 | 142 | + pectinesterase | ||
| PLN03043 | PLN03043 | 7.0e-81 | 1 | 144 | 144 | + Probable pectinesterase/pectinesterase inhibitor; Provisional | ||
| PLN02916 | PLN02916 | 8.0e-83 | 1 | 145 | 145 | + pectinesterase family protein | ||
| PLN02713 | PLN02713 | 3.0e-83 | 1 | 145 | 145 | + Probable pectinesterase/pectinesterase inhibitor | ||
| pfam01095 | Pectinesterase | 6.0e-101 | 1 | 146 | 146 | + Pectinesterase. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN77092.1 | 0 | 1 | 146 | 248 | 393 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI26863.1 | 0 | 1 | 147 | 1 | 147 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_173733.1 | 0 | 1 | 145 | 304 | 448 | pectinesterase family protein [Arabidopsis thaliana] |
| RefSeq | XP_002314796.1 | 0 | 1 | 146 | 272 | 417 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002527782.1 | 0 | 1 | 146 | 270 | 415 | Pectinesterase-1 precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 0 | 1 | 146 | 60 | 205 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 0 | 1 | 143 | 56 | 198 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntq_B | 0.0000000000002 | 27 | 146 | 88 | 226 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntq_A | 0.0000000000002 | 27 | 146 | 88 | 226 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntp_B | 0.0000000000002 | 27 | 146 | 88 | 226 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| homogalacturonan degradation | RXN-2102 | EC-3.1.1.11 | pectinesterase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GW839633 | 146 | 1 | 146 | 0 |
| EE076581 | 146 | 1 | 146 | 0 |
| EC939603 | 146 | 1 | 146 | 0 |
| EE258331 | 146 | 1 | 146 | 0 |
| EE257298 | 146 | 1 | 146 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |