Basic Information | |
---|---|
Species | Vitis vinifera |
Cazyme ID | GSVIVT01011699001 |
Family | CE8 |
Protein Properties | Length: 148 Molecular Weight: 16135.8 Isoelectric Point: 7.0383 |
Chromosome | Chromosome/Scaffold: 1 Start: 5011824 End: 5018047 |
Description | Plant invertase/pectin methylesterase inhibitor superfamily |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE8 | 1 | 146 | 0 |
MIIGDGKDATIVTGNKNVQDGSTTFRSATFAVSGHGFIARDMTFENTAGPEKHQAVALRSSSDGSVFYGCSFKGYQDTLYVHTQRQFYRSCDVYGTVDFI FGDAVAVLQNCNIYVRRPMSNQANVITAQGRSDQNENTGISIHNSH |
Full Sequence |
---|
Protein Sequence Length: 148 Download |
MIIGDGKDAT IVTGNKNVQD GSTTFRSATF AVSGHGFIAR DMTFENTAGP EKHQAVALRS 60 SSDGSVFYGC SFKGYQDTLY VHTQRQFYRS CDVYGTVDFI FGDAVAVLQN CNIYVRRPMS 120 NQANVITAQG RSDQNENTGI SIHNSHY* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02314 | PLN02314 | 3.0e-78 | 1 | 142 | 142 | + pectinesterase | ||
PLN03043 | PLN03043 | 7.0e-81 | 1 | 144 | 144 | + Probable pectinesterase/pectinesterase inhibitor; Provisional | ||
PLN02916 | PLN02916 | 8.0e-83 | 1 | 145 | 145 | + pectinesterase family protein | ||
PLN02713 | PLN02713 | 3.0e-83 | 1 | 145 | 145 | + Probable pectinesterase/pectinesterase inhibitor | ||
pfam01095 | Pectinesterase | 6.0e-101 | 1 | 146 | 146 | + Pectinesterase. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0005618 | cell wall |
GO:0030599 | pectinesterase activity |
GO:0042545 | cell wall modification |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN77092.1 | 0 | 1 | 146 | 248 | 393 | hypothetical protein [Vitis vinifera] |
EMBL | CBI26863.1 | 0 | 1 | 147 | 1 | 147 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_173733.1 | 0 | 1 | 145 | 304 | 448 | pectinesterase family protein [Arabidopsis thaliana] |
RefSeq | XP_002314796.1 | 0 | 1 | 146 | 272 | 417 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002527782.1 | 0 | 1 | 146 | 270 | 415 | Pectinesterase-1 precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1gq8_A | 0 | 1 | 146 | 60 | 205 | A Chain A, Pectin Methylesterase From Carrot |
PDB | 1xg2_A | 0 | 1 | 143 | 56 | 198 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 2ntq_B | 0.0000000000002 | 27 | 146 | 88 | 226 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 2ntq_A | 0.0000000000002 | 27 | 146 | 88 | 226 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 2ntp_B | 0.0000000000002 | 27 | 146 | 88 | 226 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
homogalacturonan degradation | RXN-2102 | EC-3.1.1.11 | pectinesterase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GW839633 | 146 | 1 | 146 | 0 |
EE076581 | 146 | 1 | 146 | 0 |
EC939603 | 146 | 1 | 146 | 0 |
EE258331 | 146 | 1 | 146 | 0 |
EE257298 | 146 | 1 | 146 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|