| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01012212001 |
| Family | CBM43 |
| Protein Properties | Length: 115 Molecular Weight: 11947.4 Isoelectric Point: 6.443 |
| Chromosome | Chromosome/Scaffold: 1 Start: 523827 End: 526024 |
| Description | plasmodesmata callose-binding protein 3 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 23 | 104 | 6.9e-32 |
| CVCKDGLSDQALQKTLDYACGAGADCSPVLQNGACYNPNTVKDHCSYAVNSYFQKKGQASGSCDFAGTATQSQTNPSSVSTC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 115 Download |
| MAVLVYFVLF LAMTGHSSAA VYCVCKDGLS DQALQKTLDY ACGAGADCSP VLQNGACYNP 60 NTVKDHCSYA VNSYFQKKGQ ASGSCDFAGT ATQSQTNPSS VSTCVYPTSA RVCD* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 1.0e-21 | 22 | 92 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 1.0e-33 | 22 | 106 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACU14053.1 | 0 | 1 | 109 | 1 | 108 | unknown [Glycine max] |
| GenBank | ACU20773.1 | 0 | 1 | 109 | 1 | 108 | unknown [Glycine max] |
| EMBL | CAN73948.1 | 0 | 1 | 110 | 1 | 110 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI27282.1 | 0 | 1 | 114 | 1 | 114 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002267413.1 | 0 | 1 | 98 | 1 | 98 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 3e-22 | 18 | 111 | 9 | 101 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
