CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01012346001
FamilyAA1
Protein PropertiesLength: 502 Molecular Weight: 55857.4 Isoelectric Point: 6.6716
ChromosomeChromosome/Scaffold: 18 Start: 789119 End: 793684
Descriptionlaccase 14
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1144840
  KINLHGVSMPRYPWTDGPEYITQCPIQPGSKFSQKIILSFEEGTLWWHAHSDWTRATVHGAIIIYPKNGTKYPFPKPDAEVPIILGEWWKSDVNAVRDEG
  LATGADPNVSDSFLINGQPGDLLPCSKSSTFKLTVDHGKTYLLRIICAALHEPLFFSIAKHKMTVVGTDGSYTKPLTRDYITIYPGQTYDVLLEANQHPD
  HYYMAAKTYSSAPGSPNAFDNTTTTAIVQYRGYYTPSSPPSLPHFPAYNDTNASVQVMAGLRSLADAEHPCNVPLSPSTKLIYTVSMNSFLCPNNSCGGP
  NGTRFAASINNISFQSPTIDILQAYYYNISGVYGDKFPSVPPLVFDFTNDILPLEYQIPKNRTEVRVLEYNSTVEIVFQGTSLISGTTHPMHLHGYSFYV
  VGWGFGNFDKNKDPLHYNLVDPPLQSTISVPTKGWAAIRFEASNPGVWFMHCHVERHLTWGMETAFIVKNG
Full Sequence
Protein Sequence     Length: 502     Download
MGIGLYFRNE HMIKINLHGV SMPRYPWTDG PEYITQCPIQ PGSKFSQKII LSFEEGTLWW    60
HAHSDWTRAT VHGAIIIYPK NGTKYPFPKP DAEVPIILGE WWKSDVNAVR DEGLATGADP    120
NVSDSFLING QPGDLLPCSK SSTFKLTVDH GKTYLLRIIC AALHEPLFFS IAKHKMTVVG    180
TDGSYTKPLT RDYITIYPGQ TYDVLLEANQ HPDHYYMAAK TYSSAPGSPN AFDNTTTTAI    240
VQYRGYYTPS SPPSLPHFPA YNDTNASVQV MAGLRSLADA EHPCNVPLSP STKLIYTVSM    300
NSFLCPNNSC GGPNGTRFAA SINNISFQSP TIDILQAYYY NISGVYGDKF PSVPPLVFDF    360
TNDILPLEYQ IPKNRTEVRV LEYNSTVEIV FQGTSLISGT THPMHLHGYS FYVVGWGFGN    420
FDKNKDPLHY NLVDPPLQST ISVPTKGWAA IRFEASNPGV WFMHCHVERH LTWGMETAFI    480
VKNGKHLEAE MLPPPSDMPP C*                                             540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00394Cu-oxidase3.0e-4493245157+
PLN02191PLN021914.0e-5915480496+
PLN02604PLN026044.0e-6913479498+
TIGR03388ascorbase5.0e-7415479495+
TIGR03389laccase013501490+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN60212.10350161559hypothetical protein [Vitis vinifera]
EMBLCBI29319.1015011501unnamed protein product [Vitis vinifera]
RefSeqXP_002264702.10350167565PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002268422.10350167565PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002271127.10350167565PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B01347957521A Chain A, Structure Of Human Cpsf-73
PDB1asq_A01347957521A Chain A, Structure Of Human Cpsf-73
PDB1asp_B01347957521A Chain A, Structure Of Human Cpsf-73
PDB1asp_A01347957521A Chain A, Structure Of Human Cpsf-73
PDB1aso_B01347957521A Chain A, Structure Of Human Cpsf-73
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO797675495105020
CF2038712462575020
CD0078122201723910
HS0594412402454840
JK4896192842084890
Orthologous Group
SpeciesID
Arabidopsis lyrata917686487747
Arabidopsis thalianaAT5G48100.1AT5G09360.1
Brachypodium distachyonBradi3g59210.1Bradi3g59187.1
Brassica rapaBra020720Bra037510
Capsella rubellaCarubv10027828mCarubv10000589m
Citrus clementinaCiclev10003795m
Citrus sinensisorange1.1g036841m
Cucumis sativusCucsa.345760.1
Eucalyptus grandisEucgr.L01441.1Eucgr.J00889.1Eucgr.F02650.1Eucgr.H04936.1Eucgr.F04163.1
Eucgr.F02674.1Eucgr.H04937.1Eucgr.F02648.1Eucgr.F02642.1Eucgr.F02646.1
Eucgr.L00623.1Eucgr.B01273.1Eucgr.H02579.1Eucgr.F02649.1Eucgr.F04160.1
Eucgr.F04162.1Eucgr.F02641.1Eucgr.F04154.1Eucgr.L01656.1Eucgr.F02644.1
Eucgr.L00621.1Eucgr.C02745.1Eucgr.J00888.1Eucgr.F02652.2Eucgr.F02652.1
Eucgr.L01343.1Eucgr.L02310.1Eucgr.E04216.1Eucgr.G00841.1Eucgr.E04217.1
Eucgr.E04220.1Eucgr.E04219.1Eucgr.E04218.1Eucgr.E04221.1Eucgr.L01345.1
Eucgr.E03935.1Eucgr.F04158.1Eucgr.F02653.1Eucgr.E03932.1Eucgr.F04157.1
Eucgr.F02642.2Eucgr.F02649.2
Fragaria vescamrna16187.1-v1.0-hybridmrna27556.1-v1.0-hybridmrna27557.1-v1.0-hybridmrna27526.1-v1.0-hybridmrna27527.1-v1.0-hybrid
mrna27523.1-v1.0-hybridmrna15091.1-v1.0-hybridmrna27531.1-v1.0-hybridmrna24290.1-v1.0-hybridmrna27522.1-v1.0-hybrid
mrna17621.1-v1.0-hybridmrna11910.1-v1.0-hybridmrna24296.1-v1.0-hybridmrna05430.1-v1.0-hybridmrna24295.1-v1.0-hybrid
mrna02152.1-v1.0-hybridmrna24292.1-v1.0-hybridmrna08067.1-v1.0-hybridmrna11940.1-v1.0-hybrid
Glycine maxGlyma11g36058.1Glyma16g27480.1Glyma10g36320.1Glyma20g31280.1Glyma10g36310.1
Glyma20g31270.1
Gossypium raimondiiGorai.009G260400.1Gorai.009G260400.2Gorai.005G076600.2Gorai.005G076600.1Gorai.005G076600.3
Gorai.009G260600.1Gorai.009G261300.1Gorai.009G261000.1Gorai.009G260800.1Gorai.010G130100.1
Gorai.009G260400.3Gorai.009G261100.1Gorai.009G261500.1
Linum usitatissimumLus10041067Lus10026812Lus10036070Lus10041066
Malus domesticaMDP0000546342MDP0000143780MDP0000168293MDP0000318606MDP0000262848
MDP0000090732MDP0000242301MDP0000252988MDP0000724206MDP0000419919
MDP0000188477MDP0000263468MDP0000148967
Manihot esculentacassava4.1_028126mcassava4.1_005540mcassava4.1_026478mcassava4.1_027769m
Medicago truncatulaMedtr3g101640.1.30.558Medtr3g101640.1.30.558Medtr2g008330.1
Mimulus guttatusmgv1a018195mmgv1a019066mmgv1a021399mmgv1a003690mmgv1a004060m
Oryza sativaLOC_Os02g51440.1LOC_Os11g47390.1
Panicum virgatumPavirv00068445mPavirv00039877mPavirv00029470mPavirv00044315mPavirv00029948m
Phaseolus vulgarisPhvul.004G086400.1Phvul.007G086400.1Phvul.007G086500.1Phvul.004G087000.1
Populus trichocarpaPotri.005G200600.1Potri.005G200500.1Potri.011G071100.1Potri.019G088900.1Potri.019G088500.1
Potri.019G088600.1Potri.019G088800.1Potri.019G088700.1Potri.019G088700.2Potri.005G200700.1
Potri.001G206200.1Potri.005G200500.2Potri.005G200600.2
Prunus persicappa016123mppa003529mppa003546mppa016865mppa015996m
ppa025323mppa003489mppa014804mppa003580mppa003663m
ppa003583mppa025087m
Ricinus communis28644.m00090929703.m00152429703.m00152729703.m00153128660.m000189
29703.m00153028644.m00094028644.m00093728644.m000938
Setaria italicaSi016752mSi007952mSi019864mSi019724m
Sorghum bicolorSb04g027860.1Sb04g034620.1Sb04g034610.1Sb04g027850.1Sb10g030340.1
Sb05g022480.1
Thellungiella halophilaThhalv10003921mThhalv10015612m
Vitis viniferaGSVIVT01001603001GSVIVT01012329001GSVIVT01013689001GSVIVT01013695001GSVIVT01013694001
GSVIVT01012332001GSVIVT01034783001GSVIVT01012343001GSVIVT01034842001GSVIVT01034817001
GSVIVT01001604001GSVIVT01001614001GSVIVT01013687001.321.754GSVIVT01013687001.321.754GSVIVT01012359001
GSVIVT01034828001GSVIVT01013692001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)