| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01012605001 |
| Family | GH35 |
| Protein Properties | Length: 119 Molecular Weight: 13903.3 Isoelectric Point: 7.8151 |
| Chromosome | Chromosome/Scaffold: 16 Start: 4547946 End: 4553936 |
| Description | beta-galactosidase 10 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH35 | 1 | 108 | 6.1e-38 |
| MWSGLVKTAKEGGIDVIETYVFWNGHELSPGNYYFGGWYDLLKFVKIVQQDGMYLILRFGPFVVAEWNFSGVLVWLHYMPGTVFWTNSEPFNYHMQKFMT LVVNIMKK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 119 Download |
| MWSGLVKTAK EGGIDVIETY VFWNGHELSP GNYYFGGWYD LLKFVKIVQQ DGMYLILRFG 60 PFVVAEWNFS GVLVWLHYMP GTVFWTNSEP FNYHMQKFMT LVVNIMKKEK LLHLKEVL* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG1874 | LacA | 4.0e-5 | 1 | 77 | 79 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam01301 | Glyco_hydro_35 | 1.0e-38 | 1 | 106 | 106 | + Glycosyl hydrolases family 35. | ||
| PLN03059 | PLN03059 | 1.0e-41 | 1 | 106 | 106 | + beta-galactosidase; Provisional | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAF70823.1 | 0 | 1 | 111 | 76 | 186 | AF154422_1 beta-galactosidase [Solanum lycopersicum] |
| EMBL | CBI18695.1 | 0 | 14 | 118 | 9 | 113 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI21600.1 | 0 | 1 | 111 | 53 | 163 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI25664.1 | 0 | 1 | 118 | 1 | 118 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI33129.1 | 0 | 14 | 111 | 69 | 166 | unnamed protein product [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3d3a_A | 0.000000000000003 | 2 | 76 | 39 | 113 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8d_B | 0.00000000000006 | 13 | 76 | 45 | 108 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8d_A | 0.00000000000006 | 13 | 76 | 45 | 108 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8c_B | 0.00000000000006 | 13 | 76 | 45 | 108 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| PDB | 4e8c_A | 0.00000000000006 | 13 | 76 | 45 | 108 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| lactose degradation III | BETAGALACTOSID-RXN | EC-3.2.1.23 | β-galactosidase |
| Transmembrane Domains | |||||
|---|---|---|---|---|---|
| Start | End | ||||
| 54 | 76 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EE063851 | 106 | 1 | 106 | 0 |
| FY921632 | 106 | 1 | 106 | 0 |
| GT657320 | 106 | 1 | 106 | 0 |
| DB712489 | 106 | 1 | 106 | 0 |
| HX720961 | 106 | 1 | 106 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Fragaria vesca | mrna24183.1-v1.0-hybrid | ||||
| Vitis vinifera | GSVIVT01022324001 | GSVIVT01001735001 | GSVIVT01003541001 | GSVIVT01003629001 | |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |