y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01013692001
FamilyAA1
Protein PropertiesLength: 421 Molecular Weight: 47042.3 Isoelectric Point: 5.0367
ChromosomeChromosome/Scaffold: 18 Start: 2709744 End: 2714717
Descriptionlaccase 14
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1233890
  AFTINGEPGDLVACGGETTHRWLVDYGKTYLLRIVNAVVNSELFFAISEHNLTIVGTDGTYTKPRVTSYIMIAPGQTMDVLITTNQSLSHYYMAARQFVT
  LESSIAEFNNMTATAILQYRGNYPPPDVPSFPANLPLFHDLDSGLGFLPLLRSLATPEHPVSVPLKITTRMLVTASINKVNYTFEGTEVSHLAASLNNIT
  FMDPTSSILLAYYRHTSGVYTTDFPDYPPSYYNFTGDTYPPPMSVLATKVKVLNYNESVEIIVQGTNLQGQGEDHPLHLHGYTFYVVGMGRGNFNNETDP
  KWYNLVDPPERDTITVPKNGWVALRFLANNPGVWLWHCHFDRHLTWGMDTAFIVKNGETPETSILPP
Full Sequence
Protein Sequence     Length: 421     Download
MNQYFIAKEF LSNQTVTTLD DIAFTINGEP GDLVACGGET THRWLVDYGK TYLLRIVNAV    60
VNSELFFAIS EHNLTIVGTD GTYTKPRVTS YIMIAPGQTM DVLITTNQSL SHYYMAARQF    120
VTLESSIAEF NNMTATAILQ YRGNYPPPDV PSFPANLPLF HDLDSGLGFL PLLRSLATPE    180
HPVSVPLKIT TRMLVTASIN KVNYTFEGTE VSHLAASLNN ITFMDPTSSI LLAYYRHTSG    240
VYTTDFPDYP PSYYNFTGDT YPPPMSVLAT KVKVLNYNES VEIIVQGTNL QGQGEDHPLH    300
LHGYTFYVVG MGRGNFNNET DPKWYNLVDP PERDTITVPK NGWVALRFLA NNPGVWLWHC    360
HFDRHLTWGM DTAFIVKNGE TPETSILPPL AYMPSCAVQS PIRLEDFQDS IELVNKINVN    420
*                                                                    480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02191PLN021917.0e-3736375346+
pfam07731Cu-oxidase_27.0e-39245380142+
TIGR03388ascorbase1.0e-5446387354+
PLN02604PLN026045.0e-5549387351+
TIGR03389laccase9.0e-14923396380+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN63252.108420304742hypothetical protein [Vitis vinifera]
EMBLCBI29354.1014201420unnamed protein product [Vitis vinifera]
EMBLCBI29356.108420177589unnamed protein product [Vitis vinifera]
RefSeqXP_002263831.106415179588PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002263871.108420180592PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B1e-3627386189536B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB1asq_A1e-3627386189536B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB1asp_B1e-3627386189536B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB1asp_A1e-3627386189536B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB1aso_B1e-3627386189536B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FQ449073275983720
FQ422739256983530
FQ416431239132500
EC9496632531604120
FQ4415011472694150
Orthologous Group
SpeciesID
Arabidopsis lyrata917686487747
Arabidopsis thalianaAT5G48100.1AT5G09360.1
Brachypodium distachyonBradi3g59210.1Bradi3g59187.1
Brassica rapaBra020720Bra037510
Capsella rubellaCarubv10027828mCarubv10000589m
Citrus clementinaCiclev10003795m
Citrus sinensisorange1.1g036841m
Cucumis sativusCucsa.345760.1
Eucalyptus grandisEucgr.L01441.1Eucgr.J00889.1Eucgr.F02650.1Eucgr.H04936.1Eucgr.F04163.1
Eucgr.F02674.1Eucgr.H04937.1Eucgr.F02648.1Eucgr.F02642.1Eucgr.F02646.1
Eucgr.L00623.1Eucgr.B01273.1Eucgr.H02579.1Eucgr.F02649.1Eucgr.F04160.1
Eucgr.F04162.1Eucgr.F02641.1Eucgr.F04154.1Eucgr.L01656.1Eucgr.F02644.1
Eucgr.L00621.1Eucgr.C02745.1Eucgr.J00888.1Eucgr.F02652.2Eucgr.F02652.1
Eucgr.L01343.1Eucgr.L02310.1Eucgr.E04216.1Eucgr.G00841.1Eucgr.E04217.1
Eucgr.E04220.1Eucgr.E04219.1Eucgr.E04218.1Eucgr.E04221.1Eucgr.L01345.1
Eucgr.E03935.1Eucgr.F04158.1Eucgr.F02653.1Eucgr.E03932.1Eucgr.F04157.1
Eucgr.F02642.2Eucgr.F02649.2
Fragaria vescamrna16187.1-v1.0-hybridmrna27556.1-v1.0-hybridmrna27557.1-v1.0-hybridmrna27526.1-v1.0-hybridmrna27527.1-v1.0-hybrid
mrna27523.1-v1.0-hybridmrna15091.1-v1.0-hybridmrna27531.1-v1.0-hybridmrna24290.1-v1.0-hybridmrna27522.1-v1.0-hybrid
mrna17621.1-v1.0-hybridmrna11910.1-v1.0-hybridmrna24296.1-v1.0-hybridmrna05430.1-v1.0-hybridmrna24295.1-v1.0-hybrid
mrna02152.1-v1.0-hybridmrna24292.1-v1.0-hybridmrna08067.1-v1.0-hybridmrna11940.1-v1.0-hybrid
Glycine maxGlyma11g36058.1Glyma16g27480.1Glyma10g36320.1Glyma20g31280.1Glyma10g36310.1
Glyma20g31270.1
Gossypium raimondiiGorai.009G260400.1Gorai.009G260400.2Gorai.005G076600.2Gorai.005G076600.1Gorai.005G076600.3
Gorai.009G260600.1Gorai.009G261300.1Gorai.009G261000.1Gorai.009G260800.1Gorai.010G130100.1
Gorai.009G260400.3Gorai.009G261100.1Gorai.009G261500.1
Linum usitatissimumLus10041067Lus10026812Lus10036070Lus10041066
Malus domesticaMDP0000546342MDP0000143780MDP0000168293MDP0000318606MDP0000262848
MDP0000090732MDP0000242301MDP0000252988MDP0000724206MDP0000419919
MDP0000188477MDP0000263468MDP0000148967
Manihot esculentacassava4.1_028126mcassava4.1_005540mcassava4.1_026478mcassava4.1_027769m
Medicago truncatulaMedtr3g101640.1.30.558Medtr3g101640.1.30.558Medtr2g008330.1
Mimulus guttatusmgv1a018195mmgv1a019066mmgv1a021399mmgv1a003690mmgv1a004060m
Oryza sativaLOC_Os02g51440.1LOC_Os11g47390.1
Panicum virgatumPavirv00068445mPavirv00039877mPavirv00029470mPavirv00044315mPavirv00029948m
Phaseolus vulgarisPhvul.004G086400.1Phvul.007G086400.1Phvul.007G086500.1Phvul.004G087000.1
Populus trichocarpaPotri.005G200600.1Potri.005G200500.1Potri.011G071100.1Potri.019G088900.1Potri.019G088500.1
Potri.019G088600.1Potri.019G088800.1Potri.019G088700.1Potri.019G088700.2Potri.005G200700.1
Potri.001G206200.1Potri.005G200500.2Potri.005G200600.2
Prunus persicappa016123mppa003529mppa003546mppa016865mppa015996m
ppa025323mppa003489mppa014804mppa003580mppa003663m
ppa003583mppa025087m
Ricinus communis28644.m00090929703.m00152429703.m00152729703.m00153128660.m000189
29703.m00153028644.m00094028644.m00093728644.m000938
Setaria italicaSi016752mSi007952mSi019864mSi019724m
Sorghum bicolorSb04g027860.1Sb04g034620.1Sb04g034610.1Sb04g027850.1Sb10g030340.1
Sb05g022480.1
Thellungiella halophilaThhalv10003921mThhalv10015612m
Vitis viniferaGSVIVT01001603001GSVIVT01012329001GSVIVT01013689001GSVIVT01013695001GSVIVT01013694001
GSVIVT01012332001GSVIVT01034783001GSVIVT01012343001GSVIVT01034842001GSVIVT01034817001
GSVIVT01001604001GSVIVT01001614001GSVIVT01012346001GSVIVT01013687001.321.754GSVIVT01013687001.321.754
GSVIVT01012359001GSVIVT01034828001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)