y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01014265001
FamilyGT1
Protein PropertiesLength: 369 Molecular Weight: 40401.6 Isoelectric Point: 6.2654
ChromosomeChromosome/Scaffold: 19 Start: 2128359 End: 2130017
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11673524.3e-22
  QWLGGFKPGSIIFCAFGSQYILEKDQFQELVLGLELTGLPFLVALKPPTGAATIEEALPEGFKERVGGRAAVHGGWVQQPSILSHPSVGCFVSHCGFGSM
  WESLMNDCQIVLVPHLGDQILNTRVLAGELQVAVEVEREENGWFSKESLCKAIKSVMDEESEVGGLVRKNHAKWKETFARPGFMSN
Full Sequence
Protein Sequence     Length: 369     Download
MFPWFAFGHM TAFLHLSNKL AERGHKITFM LPKKAQSQLQ TLNFHPTLIS FHPLSIPHVD    60
GLPPGAETAS DIPIFLTHLL ATAMDRATDQ LEAALRASNP DFLFYDCSHL APVLASRLGI    120
KAICYNVVCA ASIAIALVPA QSDAISIRTC REIEGNLCDY IGTQWAQWLG GFKPGSIIFC    180
AFGSQYILEK DQFQELVLGL ELTGLPFLVA LKPPTGAATI EEALPEGFKE RVGGRAAVHG    240
GWVQQPSILS HPSVGCFVSH CGFGSMWESL MNDCQIVLVP HLGDQILNTR VLAGELQVAV    300
EVEREENGWF SKESLCKAIK SVMDEESEVG GLVRKNHAKW KETFARPGFM SNYVDKFVGQ    360
 LQGLLDHN*                                                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02670PLN026702.0e-261134143+
PLN02670PLN026702.0e-33159362209+
PLN00414PLN004142.0e-1651362431+
PLN02208PLN022082.0e-1661362430+
PLN02764PLN027641.0e-1701366439+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI20242.1013681368unnamed protein product [Vitis vinifera]
EMBLCBI20243.10136613356unnamed protein product [Vitis vinifera]
EMBLCBI20245.10136613413unnamed protein product [Vitis vinifera]
RefSeqXP_002282717.10136813459PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002285222.10136613455PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2c9z_A2e-21167346263431A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2c1z_A2e-21167346263431A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2c1x_A2e-21167346263431A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB2vg8_A1e-20167346260448A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB2vch_A1e-20167346260448A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
Metabolic Pathways
Pathway NameReactionECProtein Name
anthocyanidin sophoroside metabolismRXN-8176EC-2.4.1cyanidin 3-O-glucoside 2''-O-glucosyltransferase
anthocyanidin sophoroside metabolismRXN-8177EC-2.4.1pelargonidin 3-O-glucoside 2''-O-glucosyltransferase
anthocyanidin sophoroside metabolismRXN-8178EC-2.4.1delphinidin 3-O-glucoside 2''-O-glucosyltransferase
superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside)RXN-8176EC-2.4.1cyanidin 3-O-glucoside 2''-O-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FC9044672481413650
EX6650502031643660
DY2967062481413650
GR1759342451433640
DK5466412471433650
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00117.1Aquca_038_00188.1Aquca_055_00115.1Aquca_023_00112.1Aquca_011_00587.1
Aquca_011_00580.1
Arabidopsis lyrata474186918511492036495482918509
475492
Arabidopsis thalianaAT3G29630.1AT5G53990.1AT5G54010.1AT5G54060.1AT1G64910.1
Brassica rapaBra029046Bra022688Bra029045
Carica papayaevm.model.supercontig_8.121
Capsella rubellaCarubv10027945m
Citrus clementinaCiclev10017784mCiclev10008184mCiclev10015186m
Citrus sinensisorange1.1g039043morange1.1g017557morange1.1g012080m
Cucumis sativusCucsa.032470.1Cucsa.148900.1Cucsa.148870.1Cucsa.148880.1Cucsa.180970.1
Eucalyptus grandisEucgr.F03293.1Eucgr.F03295.1Eucgr.K01076.1Eucgr.K01079.1Eucgr.F03297.1
Fragaria vescamrna16456.1-v1.0-hybridmrna27158.1-v1.0-hybridmrna20937.1-v1.0-hybridmrna29784.1-v1.0-hybridmrna13733.1-v1.0-hybrid
mrna16457.1-v1.0-hybrid
Glycine maxGlyma10g33790.1Glyma20g33810.1Glyma12g34045.1Glyma06g43880.1Glyma12g14050.1
Glyma13g36500.1Glyma13g36490.1Glyma06g35110.1Glyma12g34030.1Glyma08g44550.1
Glyma13g32770.1
Gossypium raimondiiGorai.007G157200.1Gorai.002G066600.1Gorai.002G065400.1Gorai.002G065400.2Gorai.002G065300.1
Gorai.010G242800.1Gorai.002G065500.1Gorai.010G230400.1Gorai.010G230200.1Gorai.009G439200.1
Linum usitatissimumLus10008453Lus10013337Lus10040178
Malus domesticaMDP0000311492MDP0000729320MDP0000319451MDP0000729321
Manihot esculentacassava4.1_028194mcassava4.1_024244mcassava4.1_026854mcassava4.1_021802mcassava4.1_007290m
Medicago truncatulaMedtr4g079270.1Medtr4g079250.1Medtr2g014900.1Medtr2g083390.1Medtr2g083420.1
Mimulus guttatusmgv1a019428mmgv1a006277mmgv1a006102mmgv1a006231mmgv1a021196m
Panicum virgatumPavirv00057507m
Phaseolus vulgarisPhvul.007G135800.1Phvul.011G136400.1Phvul.011G115700.1Phvul.005G093600.1Phvul.011G128700.1
Phvul.011G138500.1Phvul.011G138600.1Phvul.005G093300.1Phvul.005G093500.2Phvul.005G093500.1
Populus trichocarpaPotri.011G061000.1Potri.011G060300.1Potri.006G179700.1Potri.011G097900.1
Prunus persicappa022356mppa024453m
Ricinus communis29900.m00155029705.m000575
Sorghum bicolorSb08g003060.1
Thellungiella halophilaThhalv10013536mThhalv10013535mThhalv10028656mThhalv10013471m
Vitis viniferaGSVIVT01014272001GSVIVT01014269001GSVIVT01014271001GSVIVT01014270001GSVIVT01014267001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)