y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01014359001
FamilyGH5
Protein PropertiesLength: 365 Molecular Weight: 40352.2 Isoelectric Point: 5.69
ChromosomeChromosome/Scaffold: 19 Start: 2979937 End: 2982633
DescriptionCellulase (glycosyl hydrolase family 5) protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH592051.1e-24
  AYQAVVSNIADNNMMIILDSHFSKPSFHSNDIFGDQYFNPDLWVKGLTRMATVFSGVPNVVGMSLRNELRCPKQNVKDWYRYMQKGAEAVHSANPDVLVI
  ISGLSDGTDLSFLLNQQAGETSNPNKVCGRVVDSIMRRGGVLLQQGWPLMFVSELGVDDNRNLNCFFGLAAELDFDWALWTVEETNGLMNWNSSVFQ
Full Sequence
Protein Sequence     Length: 365     Download
MLDLPLTSAY QAVVSNIADN NMMIILDSHF SKPSFHSNDI FGDQYFNPDL WVKGLTRMAT    60
VFSGVPNVVG MSLRNELRCP KQNVKDWYRY MQKGAEAVHS ANPDVLVIIS GLSDGTDLSF    120
LLNQQAGETS NPNKVCGRVV DSIMRRGGVL LQQGWPLMFV SELGVDDNRN LNCFFGLAAE    180
LDFDWALWTV EETNGLMNWN SSVFQRISAL QSPLQGPDVS RVRPHKIILH PPTGLCILWE    240
SWTEPLKLGP CTKSDAWGYT PQKLLIVKGS YFCLQAVELG KPAKLSIICT KPGSNWDIIS    300
DSKMYLSTKL GDSTTVCLDV DSSSTIVTDA CKCLGRDDTC DPGSQWFKVV DSTNISRRPI    360
LQTS*                                                                420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00150Cellulase2.0e-510131126+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI20318.1013641364unnamed protein product [Vitis vinifera]
RefSeqXP_002284881.101364124509PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002284883.101364124500PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002284888.101362124507PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002284895.101362127510PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ece_B0.00113155100249A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
PDB1ece_A0.00113155100249A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
PDB1vrx_B0.00213155100249A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB1vrx_A0.00213155100249A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CF516703283773400
EE0860682271253510
EE0769962251413650
EE074733244823030
CB9198402141523650
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00429.2Aquca_011_00429.1Aquca_001_00170.1Aquca_001_00171.1Aquca_011_00425.1
Aquca_011_00424.1Aquca_011_00428.1Aquca_011_00423.1Aquca_001_00172.1
Arabidopsis lyrata471466322756864961488616326109
882032
Arabidopsis thalianaAT5G17500.1AT1G13130.1AT3G26140.1AT3G26130.1AT5G16700.1
Brachypodium distachyonBradi5g13560.1Bradi5g13550.1
Brassica rapaBra025186Bra019811Bra025187Bra026437Bra026436
Bra023580Bra013972Bra008603Bra026925
Carica papayaevm.model.supercontig_33.65evm.model.supercontig_33.69evm.model.supercontig_33.67
Capsella rubellaCarubv10008758mCarubv10019167mCarubv10016955mCarubv10002868m
Citrus clementinaCiclev10031098mCiclev10023534m
Citrus sinensisorange1.1g013842morange1.1g008330morange1.1g015062morange1.1g039248m
Cucumis sativusCucsa.286780.1Cucsa.275330.1Cucsa.115540.1Cucsa.108400.1Cucsa.115550.1
Cucsa.365480.1Cucsa.303610.1Cucsa.303620.1Cucsa.129000.1Cucsa.275320.1
Eucalyptus grandisEucgr.B03243.1Eucgr.H02462.1Eucgr.H02464.1Eucgr.H02457.1Eucgr.H02458.1
Eucgr.D01800.1
Glycine maxGlyma05g30691.1Glyma11g18350.1Glyma05g30681.1Glyma08g13880.2Glyma18g01630.1
Glyma08g13891.1Glyma08g06511.1Glyma07g08060.2
Gossypium raimondiiGorai.002G188600.1Gorai.012G173600.1
Linum usitatissimumLus10011404Lus10006462Lus10011403Lus10006461Lus10024686
Lus10032312
Malus domesticaMDP0000753366MDP0000729817
Manihot esculentacassava4.1_004696mcassava4.1_031675mcassava4.1_025125m
Medicago truncatulaMedtr4g091610.1Medtr7g012780.1Medtr7g012530.1Medtr3g086450.1Medtr7g012540.1
Medtr7g012840.1Medtr5g088330.1
Mimulus guttatusmgv1a004205mmgv1a018920mmgv1a020519mmgv1a004243mmgv1a004297m
Oryza sativaLOC_Os04g40510.2LOC_Os04g40510.1LOC_Os02g38260.1LOC_Os04g40500.1LOC_Os04g40490.1
Panicum virgatumPavirv00025159mPavirv00029795mPavirv00010845mPavirv00023661mPavirv00002791m
Pavirv00002936m
Physcomitrella patensPp1s94_121V6.1Pp1s114_176V6.1Pp1s298_71V6.1
Phaseolus vulgarisPhvul.002G258500.1Phvul.011G098000.1Phvul.002G258400.1Phvul.002G220300.1Phvul.010G095100.1
Picea abiesMA_318998g0010MA_463555g0010MA_8507901g0010MA_10432675g0010
Populus trichocarpaPotri.008G183400.2Potri.008G183400.1Potri.010G049700.1Potri.010G049800.1Potri.008G183400.3
Potri.001G097900.1Potri.T144300.1
Prunus persicappa003807m
Ricinus communis29929.m00479230190.m01129330190.m01129230190.m011291
Setaria italicaSi019475mSi009742mSi009751mSi009695m
Sorghum bicolorSb06g020270.1Sb06g020260.1Sb04g024910.1
Thellungiella halophilaThhalv10007253mThhalv10003934mThhalv10004045mThhalv10003968mThhalv10015581m
Thhalv10015466m
Vitis viniferaGSVIVT01000573001GSVIVT01019434001.470.783GSVIVT01019434001.470.783GSVIVT01019434001.35.351GSVIVT01019434001.35.351
GSVIVT01019433001GSVIVT01019436001GSVIVT01014358001GSVIVT01014355001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)