| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01017354001 |
| Family | GH28 |
| Protein Properties | Length: 89 Molecular Weight: 9313.8 Isoelectric Point: 10.3348 |
| Chromosome | Chromosome/Scaffold: 9 Start: 7142261 End: 7142744 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH28 | 2 | 87 | 3.7e-35 |
| VLKGLTHLNSQKQHIVITKCHGALISKIKVIAPEDSPNTDGINIASSKNVRVQRSHISTGDDCIAISAGSSNIKIKGMTCAPSHGI | |||
| Full Sequence |
|---|
| Protein Sequence Length: 89 Download |
| MVLKGLTHLN SQKQHIVITK CHGALISKIK VIAPEDSPNT DGINIASSKN VRVQRSHIST 60 GDDCIAISAG SSNIKIKGMT CAPSHGIR* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02793 | PLN02793 | 1.0e-23 | 1 | 87 | 87 | + Probable polygalacturonase | ||
| pfam00295 | Glyco_hydro_28 | 1.0e-26 | 3 | 87 | 85 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
| PLN02188 | PLN02188 | 4.0e-27 | 1 | 87 | 87 | + polygalacturonase/glycoside hydrolase family protein | ||
| PLN03010 | PLN03010 | 3.0e-27 | 1 | 87 | 87 | + polygalacturonase | ||
| PLN03003 | PLN03003 | 1.0e-27 | 3 | 87 | 85 | + Probable polygalacturonase At3g15720 | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004650 | polygalacturonase activity |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN74551.1 | 2e-27 | 1 | 87 | 76 | 162 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI33426.1 | 2e-30 | 1 | 87 | 128 | 214 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI36346.1 | 0 | 1 | 88 | 1 | 88 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002265133.1 | 0 | 1 | 87 | 136 | 222 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002271052.1 | 4e-29 | 1 | 87 | 70 | 156 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1bhe_A | 0.00000007 | 1 | 69 | 162 | 230 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
| PDB | 1hg8_A | 0.000003 | 39 | 87 | 165 | 212 | A Chain A, Endopolygalacturonase From The Phytopathogenic Fungus Fusarium Moniliforme |
| PDB | 1nhc_F | 0.00003 | 39 | 87 | 152 | 199 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_E | 0.00003 | 39 | 87 | 152 | 199 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_D | 0.00003 | 39 | 87 | 152 | 199 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| homogalacturonan degradation | RXN-2103 | EC-3.2.1.15 | polygalacturonase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| DY961682 | 85 | 3 | 87 | 5e-30 |
| DY964976 | 85 | 3 | 87 | 1e-29 |
| EH673898 | 81 | 3 | 83 | 3e-28 |
| DY971212 | 83 | 1 | 83 | 4e-28 |
| CX946604 | 85 | 3 | 87 | 1e-26 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |