| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01020198001 |
| Family | GH3 |
| Protein Properties | Length: 126 Molecular Weight: 14191.1 Isoelectric Point: 5.1506 |
| Chromosome | Chromosome/Scaffold: 1 Start: 9185076 End: 9187047 |
| Description | Glycosyl hydrolase family protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH3 | 32 | 119 | 1.2e-26 |
| PLKVSSCCKHYAAYDIDSWLNIDRHTFDARVSEQDMKETFVSPFERCVREGDVSSVMCSFNKINGIPPCSDPRLLKGVIRDEWDLHGY | |||
| Full Sequence |
|---|
| Protein Sequence Length: 126 Download |
| MVNIGNLLYL GVNGIFISEL LEFNVTDLNS RPLKVSSCCK HYAAYDIDSW LNIDRHTFDA 60 RVSEQDMKET FVSPFERCVR EGDVSSVMCS FNKINGIPPC SDPRLLKGVI RDEWDLHGYG 120 SNNLK* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PRK15098 | PRK15098 | 3.0e-7 | 40 | 118 | 79 | + beta-D-glucoside glucohydrolase; Provisional | ||
| COG1472 | BglX | 3.0e-14 | 34 | 114 | 83 | + Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism] | ||
| pfam00933 | Glyco_hydro_3 | 9.0e-23 | 34 | 119 | 86 | + Glycosyl hydrolase family 3 N terminal domain. | ||
| PLN03080 | PLN03080 | 1.0e-30 | 33 | 119 | 87 | + Probable beta-xylosidase; Provisional | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI25985.1 | 0 | 24 | 119 | 34 | 129 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI25987.1 | 0 | 35 | 119 | 223 | 307 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI32115.1 | 0 | 1 | 125 | 1 | 125 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002265788.1 | 0 | 24 | 119 | 180 | 275 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002274591.1 | 0 | 24 | 119 | 222 | 317 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2x42_A | 0.000000002 | 35 | 119 | 158 | 238 | A Chain A, Structure Of Beta-Glucosidase 3b From Thermotoga Neapolitana In Complex With Alpha-D-Glucose |
| PDB | 2x41_A | 0.000000002 | 35 | 119 | 158 | 238 | A Chain A, Structure Of Beta-Glucosidase 3b From Thermotoga Neapolitana In Complex With Alpha-D-Glucose |
| PDB | 2x40_A | 0.000000002 | 35 | 119 | 158 | 238 | A Chain A, Structure Of Beta-Glucosidase 3b From Thermotoga Neapolitana In Complex With Glycerol |
| PDB | 4i3g_B | 0.000000003 | 37 | 119 | 193 | 270 | A Chain A, Crystal Structure Of Desr, A Beta-glucosidase From Streptomyces Venezuelae In Complex With D-glucose. |
| PDB | 4i3g_A | 0.000000003 | 37 | 119 | 193 | 270 | A Chain A, Crystal Structure Of Desr, A Beta-glucosidase From Streptomyces Venezuelae In Complex With D-glucose. |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CO522120 | 93 | 27 | 119 | 9.99967e-42 |
| GR523867 | 94 | 26 | 119 | 3.00004e-41 |
| CO528615 | 93 | 27 | 119 | 5.99994e-41 |
| EX934682 | 104 | 16 | 119 | 3e-37 |
| AJ772763 | 93 | 27 | 119 | 2e-36 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
