y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01020329001
FamilyGH28
Protein PropertiesLength: 193 Molecular Weight: 21630.9 Isoelectric Point: 10.0944
ChromosomeChromosome/Scaffold: 19 Start: 21265508 End: 21281525
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH28231704.4e-31
  CGNACASPMASTVMIPEGTYALGQITIGGPCKAPINFIVQGTMKAPVDTSRFKAEAGWIAFQQIDQFTLFGGGVFYGQGKTVWGRKSPRSAYCNQLPINL
  RFNFITNSMVNDITSRDSKQFHINLLGCKNLTFYNIAISAPEESLNTD
Full Sequence
Protein Sequence     Length: 193     Download
MARTDKNIEV VILSRCVALL KACGNACASP MASTVMIPEG TYALGQITIG GPCKAPINFI    60
VQGTMKAPVD TSRFKAEAGW IAFQQIDQFT LFGGGVFYGQ GKTVWGRKSP RSAYCNQLPI    120
NLRFNFITNS MVNDITSRDS KQFHINLLGC KNLTFYNIAI SAPEESLNTD RWKSHWTFLR    180
DQYHRFNHRN RR*                                                       240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02793PLN027933.0e-1926170150+
PLN02218PLN022188.0e-2218170158+
PLN02155PLN021551.0e-2618170154+
PLN02188PLN021888.0e-3518170154+
pfam00295Glyco_hydro_282.0e-3727170144+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI21721.1011921192unnamed protein product [Vitis vinifera]
EMBLCBI22050.10217035198unnamed protein product [Vitis vinifera]
EMBLCBI28390.101817046198unnamed protein product [Vitis vinifera]
RefSeqXP_002269648.101817015167PREDICTED: hypothetical protein, partial [Vitis vinifera]
RefSeqXP_002274125.101817046198PREDICTED: hypothetical protein [Vitis vinifera]
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2103EC-3.2.1.15polygalacturonase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC987202153181700
EC941822153181700
DT010865153181700
GW837750115181320
CO121861155171700
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_48.193
Linum usitatissimumLus10006171
Malus domesticaMDP0000731047
Manihot esculentacassava4.1_026308mcassava4.1_027361mcassava4.1_033443mcassava4.1_022207mcassava4.1_030899m
Medicago truncatulaMedtr2g100040.1.47.188Medtr2g100040.1.47.188
Panicum virgatumPavirv00028285mPavirv00015111m
Phaseolus vulgarisPhvul.007G076500.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny