| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01021359001 |
| Family | GH16 |
| Protein Properties | Length: 201 Molecular Weight: 23090.1 Isoelectric Point: 8.4339 |
| Chromosome | Chromosome/Scaffold: 10 Start: 4429965 End: 4431287 |
| Description | xyloglucan endotransglucosylase/hydrolase 15 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH16 | 4 | 135 | 1.3e-21 |
| KLVSGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTENFHTYSIIWNLQNIIFLVDNIPIREFKNQESIGVP FPKSQPMRIYSSLWNADDWATRGGLVKIDWSK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 201 Download |
| MQLKLVSGNS AGTVTAYYLS SQGPTHDEID FEFLGNLSGD PYILHTNVFT QGKGNREQQF 60 YLWFDPTENF HTYSIIWNLQ NIIFLVDNIP IREFKNQESI GVPFPKSQPM RIYSSLWNAD 120 DWATRGGLVK IDWSKAPFTA SYRNFNAAAC LPVSNIAWQN QGLDAKSRRK LQWVQKNYMI 180 YNYCSDMKRF PGGLPLECRH * 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam06955 | XET_C | 6.0e-19 | 157 | 198 | 45 | + Xyloglucan endo-transglycosylase (XET) C-terminus. This family represents the C-terminus (approximately 60 residues) of plant xyloglucan endo-transglycosylase (XET). Xyloglucan is the predominant hemicellulose in the cell walls of most dicotyledons. With cellulose, it forms a network that strengthens the cell wall. XET catalyzes the splitting of xyloglucan chains and the linking of the newly generated reducing end to the non-reducing end of another xyloglucan chain, thereby loosening the cell wall. Note that all family members contain the pfam00722 domain. | ||
| cd02183 | GH16_fungal_CRH1_transglycosylase | 4.0e-24 | 9 | 147 | 154 | + glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
| pfam00722 | Glyco_hydro_16 | 6.0e-63 | 1 | 135 | 137 | + Glycosyl hydrolases family 16. | ||
| PLN03161 | PLN03161 | 5.0e-93 | 1 | 198 | 213 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
| cd02176 | GH16_XET | 3.0e-129 | 1 | 198 | 213 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005618 | cell wall |
| GO:0005975 | carbohydrate metabolic process |
| GO:0006073 | cellular glucan metabolic process |
| GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACD03218.1 | 0 | 1 | 200 | 72 | 281 | xyloglucan endotransglucosylase/hydrolase 8 [Actinidia deliciosa] |
| EMBL | CBI30796.1 | 0 | 1 | 200 | 1 | 193 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI30800.1 | 0 | 1 | 200 | 1 | 200 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002268708.1 | 0 | 1 | 200 | 77 | 290 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002270973.1 | 0 | 1 | 200 | 115 | 328 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1un1_B | 0 | 1 | 199 | 64 | 273 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 1un1_A | 0 | 1 | 199 | 64 | 273 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 1umz_B | 0 | 1 | 199 | 64 | 273 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 1umz_A | 0 | 1 | 199 | 64 | 273 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 2uwb_B | 0 | 3 | 189 | 67 | 259 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EC939521 | 214 | 1 | 200 | 0 |
| EC945842 | 214 | 1 | 200 | 0 |
| EC936374 | 214 | 1 | 200 | 0 |
| CF207914 | 211 | 4 | 200 | 0 |
| GR053028 | 202 | 1 | 201 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
