Basic Information | |
---|---|
Species | Vitis vinifera |
Cazyme ID | GSVIVT01022324001 |
Family | GH35 |
Protein Properties | Length: 84 Molecular Weight: 9469.01 Isoelectric Point: 7.5035 |
Chromosome | Chromosome/Scaffold: 7 Start: 18504906 End: 18505762 |
Description | beta-galactosidase 10 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH35 | 1 | 79 | 1.1e-33 |
MWSGLVRIAKEGGIVVFETYVFWNGHELSPGNYYFGGRYDLLKFVKIVQQAGMYLILCIGPFVAAEWNFGGVPVWLHYV |
Full Sequence |
---|
Protein Sequence Length: 84 Download |
MWSGLVRIAK EGGIVVFETY VFWNGHELSP GNYYFGGRYD LLKFVKIVQQ AGMYLILCIG 60 PFVAAEWNFG GVPVWLHYVT FSN* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG1874 | LacA | 6.0e-7 | 1 | 77 | 79 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
pfam01301 | Glyco_hydro_35 | 4.0e-33 | 1 | 79 | 79 | + Glycosyl hydrolases family 35. | ||
PLN03059 | PLN03059 | 1.0e-36 | 1 | 79 | 79 | + beta-galactosidase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAF70823.1 | 1.99993e-41 | 1 | 79 | 76 | 154 | AF154422_1 beta-galactosidase [Solanum lycopersicum] |
EMBL | CBI21589.1 | 0 | 1 | 83 | 1 | 83 | unnamed protein product [Vitis vinifera] |
EMBL | CBI21600.1 | 3e-40 | 1 | 79 | 53 | 131 | unnamed protein product [Vitis vinifera] |
EMBL | CBI25664.1 | 8.99999e-40 | 1 | 79 | 1 | 79 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002522927.1 | 3e-37 | 1 | 79 | 59 | 137 | beta-galactosidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3d3a_A | 0.000000000000003 | 2 | 76 | 39 | 113 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 4e8d_B | 0.000000000000005 | 13 | 76 | 45 | 108 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 4e8d_A | 0.000000000000005 | 13 | 76 | 45 | 108 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 4e8c_B | 0.000000000000005 | 13 | 76 | 45 | 108 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
PDB | 4e8c_A | 0.000000000000005 | 13 | 76 | 45 | 108 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
lactose degradation III | BETAGALACTOSID-RXN | EC-3.2.1.23 | β-galactosidase |
Transmembrane Domains | |||||
---|---|---|---|---|---|
Start | End | ||||
54 | 76 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FY921632 | 79 | 1 | 79 | 7.00649e-43 |
EE063851 | 82 | 1 | 82 | 1.00053e-42 |
GT657320 | 79 | 1 | 79 | 1.00053e-42 |
DB712489 | 79 | 1 | 79 | 3.00018e-42 |
FG521505 | 79 | 1 | 79 | 9.99967e-42 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Fragaria vesca | mrna24183.1-v1.0-hybrid | ||||
Vitis vinifera | GSVIVT01012605001 | GSVIVT01001735001 | GSVIVT01003541001 | GSVIVT01003629001 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|