y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01027026001
FamilyGH18
Protein PropertiesLength: 228 Molecular Weight: 24471.4 Isoelectric Point: 6.2318
ChromosomeChromosome/Scaffold: 15 Start: 18503370 End: 18505424
Descriptionchitinase A
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18151753.9e-24
  TALSNDIRACQGRGIKVLLSIGGGSGSYSLTSAKDARQVANYLWNNFLGGQSSSRPLGDAVLDGIDFDIVGGTDQHWDERANALSEFRHQRKVYLSAAPQ
  CPFPDAWMGTAIATGLFDYVWVQFYKNPPCQYSGNSSQLISAWNQWTTIQAGQVFLGLPAA
Full Sequence
Protein Sequence     Length: 228     Download
MNLACHCDPS SNGCTALSND IRACQGRGIK VLLSIGGGSG SYSLTSAKDA RQVANYLWNN    60
FLGGQSSSRP LGDAVLDGID FDIVGGTDQH WDERANALSE FRHQRKVYLS AAPQCPFPDA    120
WMGTAIATGL FDYVWVQFYK NPPCQYSGNS SQLISAWNQW TTIQAGQVFL GLPAAPEAAA    180
SGYIPPDVLV SQVLPYIKTS PKYGGVMLWD RYNDVQSGYS SAIKGSV*                 240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3469COG34690.000477209168+
cd02871GH18_chitinase_D-like1.0e-816214253+
pfam00704Glyco_hydro_187.0e-156214292+
cd02877GH18_hevamine_XipI_class_III2.0e-1001225237+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI40459.1012271227unnamed protein product [Vitis vinifera]
Swiss-ProtP290600122766291CHIA_TOBAC RecName: Full=Acidic endochitinase; Flags: Precursor
RefSeqXP_002276365.10122793317PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002279661.10122769289PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316626.10122747272predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2gsj_A0122744271A Chain A, Cdna Cloning And 1.75a Crystal Structure Determination Of Ppl2, A Novel Chimerolectin From Parkia Platycephala Seeds Exhibiting Endochitinolytic Activity
PDB2hvm_A0122744273A Chain A, Cdna Cloning And 1.75a Crystal Structure Determination Of Ppl2, A Novel Chimerolectin From Parkia Platycephala Seeds Exhibiting Endochitinolytic Activity
PDB1llo_A0122744273A Chain A, Cdna Cloning And 1.75a Crystal Structure Determination Of Ppl2, A Novel Chimerolectin From Parkia Platycephala Seeds Exhibiting Endochitinolytic Activity
PDB1hvq_A0122744273A Chain A, Crystal Structures Of Hevamine, A Plant Defence Protein With Chitinase And Lysozyme Activity, And Its Complex With An Inhibitor
PDB1kr1_A0122744273A Chain A, Hevamine Mutant D125aE127A IN COMPLEX WITH TETRA-Nag
Metabolic Pathways
Pathway NameReactionECProtein Name
chitin degradation II3.2.1.14-RXNEC-3.2.1.14chitinase
chitin degradation IIRXN-12623EC-3.2.1.14chitinase
chitin degradation IIRXN-12624EC-3.2.1.14chitinase
chitin degradation III (carnivorous plants)3.2.1.14-RXNEC-3.2.1.14chitinase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC97977122812280
EC93375722812280
EC94086322812280
EC96760122812280
CF20883822812280
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01441.1Aquca_229_00003.1Aquca_037_00022.1Aquca_002_01440.1Aquca_020_00079.1
Aquca_011_00549.1
Arabidopsis lyrata489265
Arabidopsis thalianaAT5G24090.1
Brachypodium distachyonBradi2g55630.1Bradi1g52625.1Bradi2g55610.1Bradi2g55620.1Bradi2g43755.1
Bradi2g47066.1Bradi2g45610.1
Brassica rapaBra026469Bra009731
Carica papayaevm.model.supercontig_184.10evm.model.supercontig_1833.1evm.model.supercontig_3.30evm.model.supercontig_80.46evm.model.supercontig_3.24
evm.model.supercontig_3.21evm.model.supercontig_3.23evm.TU.contig_34078.1
Capsella rubellaCarubv10001507m
Citrus clementinaCiclev10005491mCiclev10024434mCiclev10005522m
Citrus sinensisorange1.1g035598morange1.1g044801morange1.1g043511m
Cucumis sativusCucsa.201870.1Cucsa.258800.1Cucsa.201840.1Cucsa.201850.1Cucsa.258820.1
Cucsa.201860.1
Eucalyptus grandisEucgr.E00091.1Eucgr.E00086.1Eucgr.E00090.1Eucgr.K00308.1Eucgr.K00311.1
Eucgr.H04884.1Eucgr.L03478.1Eucgr.K00313.1
Fragaria vescamrna15598.1-v1.0-hybridmrna18987.1-v1.0-hybridmrna18986.1-v1.0-hybridmrna18999.1-v1.0-hybridmrna13147.1-v1.0-hybrid
mrna13194.1-v1.0-hybridmrna13136.1-v1.0-hybrid
Glycine maxGlyma12g25740.1Glyma16g28970.1Glyma16g28970.2Glyma18g15310.2Glyma10g37200.1
Glyma18g15230.1Glyma20g30480.1Glyma09g23136.1Glyma20g30450.1Glyma02g12660.1
Glyma01g06720.1Glyma03g41510.1Glyma07g06760.1Glyma18g15330.1Glyma08g41100.1
Glyma15g01820.4Glyma15g01820.3Glyma15g01820.2Glyma20g04645.2Glyma20g04645.1
Glyma19g22510.1Glyma05g07193.1Glyma20g30460.1
Gossypium raimondiiGorai.004G154400.1Gorai.008G118600.1Gorai.008G128500.1Gorai.008G272100.1Gorai.008G272000.1
Gorai.004G116500.1Gorai.009G389400.1Gorai.003G123100.1Gorai.009G389700.1
Linum usitatissimumLus10040420Lus10009216Lus10040419Lus10023535Lus10037985
Lus10009215Lus10023534Lus10037984Lus10010137Lus10001868
Malus domesticaMDP0000192511MDP0000888042MDP0000789304MDP0000940313MDP0000507853
MDP0000290970MDP0000218691MDP0000287581MDP0000414607MDP0000280265
MDP0000275926MDP0000222724MDP0000217803MDP0000218640MDP0000286587
MDP0000162677MDP0000275771MDP0000179027MDP0000310481MDP0000276435
MDP0000216662MDP0000841470
Manihot esculentacassava4.1_012935mcassava4.1_025190mcassava4.1_034267mcassava4.1_029485mcassava4.1_023457m
cassava4.1_026904mcassava4.1_027845mcassava4.1_012979mcassava4.1_028683mcassava4.1_012830m
Medicago truncatulaMedtr1g099310.1Medtr8g055940.1Medtr1g099290.1Medtr5g043550.1Medtr1g099320.1
Medtr1g099350.1Medtr2g102020.1Medtr7g116850.1Medtr7g116350.1Medtr6g023340.1
Mimulus guttatusmgv1a021044mmgv1a011049mmgv1a022607mmgv1a013181m
Oryza sativaLOC_Os01g47070.1LOC_Os07g19040.1LOC_Os01g64110.1LOC_Os01g64100.1LOC_Os01g49320.1
LOC_Os01g19750.1LOC_Os04g27980.1LOC_Os07g23850.1
Panicum virgatumPavirv00056413mPavirv00047799mPavirv00036743mPavirv00000209mPavirv00002369m
Pavirv00041282mPavirv00062095mPavirv00042577mPavirv00036741mPavirv00047846m
Pavirv00062097mPavirv00062098mPavirv00036739mPavirv00049525mPavirv00009907m
Pavirv00003256mPavirv00064592m
Phaseolus vulgarisPhvul.011G167300.1Phvul.004G101500.1Phvul.002G069300.1Phvul.003G049100.1Phvul.007G077800.1
Phvul.003G049000.1Phvul.006G109000.1Phvul.011G167000.1Phvul.011G166900.1
Populus trichocarpaPotri.015G023900.1Potri.015G024100.1Potri.015G024000.1Potri.012G033900.1Potri.014G091700.1
Potri.002G165700.1Potri.015G024200.1Potri.002G242000.1Potri.014G092800.1Potri.014G091600.1
Prunus persicappa009328mppa024550mppa021993mppa026927mppa022614m
ppa015812mppa023419mppa009248mppa023573m
Ricinus communis30169.m00655630174.m00867730169.m00655729717.m00023029595.m000280
30174.m00867830174.m008684
Setaria italicaSi033231mSi002396mSi002395mSi002419mSi002402m
Si039207mSi002411mSi003958mSi004596m
Selaginella moellendorffii12620315257232123231185409562.377.598
409562.377.598232630409562.48.270409562.48.27092194
236715
Sorghum bicolorSb03g030100.1Sb02g009370.1Sb02g009360.1Sb02g009380.1Sb03g040600.1
Sb02g009390.1Sb03g040570.1Sb01g050530.1Sb03g040560.1Sb03g040580.1
Sb03g040590.1Sb03g031710.1
Thellungiella halophilaThhalv10004675m
Vitis viniferaGSVIVT01027027001GSVIVT01028752001GSVIVT01027012001GSVIVT01028750001GSVIVT01032411001
GSVIVT01027014001GSVIVT01027022001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)