| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01028003001 |
| Family | GH1 |
| Protein Properties | Length: 119 Molecular Weight: 13364.2 Isoelectric Point: 7.6248 |
| Chromosome | Chromosome/Scaffold: 7 Start: 3119888 End: 3120737 |
| Description | Glycosyl hydrolase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 15 | 117 | 1.6e-28 |
| PKGNSSTEAYIAAHHILLAHASVVQLYREKYQETQQGFIGINVFAYWFVPMTNETEDIIATQRAHDFFLGWFVDVLVFGDYPGIVKKRAGTRIPSFSKDE SKQ | |||
| Full Sequence |
|---|
| Protein Sequence Length: 119 Download |
| MTPPHRCSPP FGNCPKGNSS TEAYIAAHHI LLAHASVVQL YREKYQETQQ GFIGINVFAY 60 WFVPMTNETE DIIATQRAHD FFLGWFVDVL VFGDYPGIVK KRAGTRIPSF SKDESKQV* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG2723 | BglB | 7.0e-8 | 15 | 101 | 88 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam00232 | Glyco_hydro_1 | 2.0e-10 | 19 | 117 | 102 | + Glycosyl hydrolase family 1. | ||
| PLN02998 | PLN02998 | 1.0e-29 | 1 | 118 | 119 | + beta-glucosidase | ||
| PLN02814 | PLN02814 | 3.0e-32 | 4 | 118 | 116 | + beta-glucosidase | ||
| PLN02849 | PLN02849 | 7.0e-38 | 2 | 118 | 117 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN82274.1 | 0 | 1 | 118 | 767 | 884 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI36853.1 | 0 | 1 | 118 | 1 | 118 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI36854.1 | 0 | 1 | 118 | 371 | 488 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002267595.1 | 0 | 1 | 118 | 199 | 316 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3gnr_A | 3e-32 | 1 | 118 | 191 | 309 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3gnp_A | 3e-32 | 1 | 118 | 191 | 309 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3gno_A | 3e-32 | 1 | 118 | 191 | 309 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3ptq_B | 5e-32 | 4 | 118 | 214 | 329 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3ptq_A | 5e-32 | 4 | 118 | 214 | 329 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GW838380 | 118 | 3 | 118 | 0 |
| DT008759 | 120 | 1 | 118 | 0 |
| EC927596 | 120 | 1 | 118 | 0 |
| EE097310 | 120 | 1 | 118 | 0 |
| EC948943 | 118 | 3 | 118 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Phaseolus vulgaris | Phvul.005G023900.1 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |