y
Basic Information | |
---|---|
Species | Vitis vinifera |
Cazyme ID | GSVIVT01028174001 |
Family | GT8 |
Protein Properties | Length: 248 Molecular Weight: 29021.2 Isoelectric Point: 4.6866 |
Chromosome | Chromosome/Scaffold: 7 Start: 4416339 End: 4418032 |
Description | galactinol synthase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT8 | 3 | 175 | 5.89947e-43 |
YYVINYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFELPDGHFYAVMDCFCEKTWSHTPQYKIGYCQQCPEKVQWPAELGQPPSLYFNAGMFVFEPSLS TYEDLLETLRITPATPFAEQDFLNMYFSDVYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSKPWRYT |
Full Sequence |
---|
Protein Sequence Length: 248 Download |
MAYYVINYSK LRIWEFVEYS KMIYLDGDIQ VYDNIDHLFE LPDGHFYAVM DCFCEKTWSH 60 TPQYKIGYCQ QCPEKVQWPA ELGQPPSLYF NAGMFVFEPS LSTYEDLLET LRITPATPFA 120 EQDFLNMYFS DVYKPIPLVY NLVLAMLWRH PENVELDKVK VVHYCAAGSK PWRYTGKEDN 180 MQREDIKMLV NKWWEIYNDK SLDYKKTRMM ANDYSSVLPG EQVNLEPFIA ALSEVGHVEF 240 VRAPSAA* 300 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG1442 | RfaJ | 2.0e-10 | 16 | 208 | 209 | + Lipopolysaccharide biosynthesis proteins, LPS:glycosyltransferases [Cell envelope biogenesis, outer membrane] | ||
cd04194 | GT8_A4GalT_like | 2.0e-14 | 18 | 174 | 172 | + A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS. | ||
pfam01501 | Glyco_transf_8 | 8.0e-42 | 1 | 176 | 185 | + Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase. | ||
cd02537 | GT8_Glycogenin | 6.0e-56 | 3 | 199 | 200 | + Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases. | ||
PLN00176 | PLN00176 | 0 | 1 | 247 | 247 | + galactinol synthase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0016757 | transferase activity, transferring glycosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN79630.1 | 0 | 1 | 247 | 96 | 342 | hypothetical protein [Vitis vinifera] |
EMBL | CBI36994.1 | 0 | 1 | 247 | 1 | 247 | unnamed protein product [Vitis vinifera] |
EMBL | CBI36995.1 | 0 | 1 | 247 | 1 | 247 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002279114.1 | 0 | 1 | 247 | 96 | 342 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
RefSeq | XP_002279157.1 | 0 | 1 | 247 | 94 | 340 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3usq_A | 0.00000000000005 | 6 | 198 | 102 | 274 | A Chain A, Structure Of D159sY194F GLYCOGENIN MUTANT TRUNCATED AT RESIDUE 270 |
PDB | 3v8z_A | 0.00000000000007 | 6 | 198 | 102 | 274 | A Chain A, Structure Of D159sY194F GLYCOGENIN MUTANT TRUNCATED AT RESIDUE 270 |
PDB | 3v8y_A | 0.00000000000007 | 6 | 198 | 102 | 274 | A Chain A, Structure Of Apo-Glycogenin Truncated At Residue 270 |
PDB | 1zct_B | 0.00000000000007 | 6 | 198 | 102 | 274 | A Chain A, Structure Of Glycogenin Truncated At Residue 270 In A Complex With Udp |
PDB | 1zct_A | 0.00000000000007 | 6 | 198 | 102 | 274 | A Chain A, Structure Of Glycogenin Truncated At Residue 270 In A Complex With Udp |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
B series fagopyritols biosynthesis | RXN-8435 | EC-2.4.1 | fagopyritol B1 synthase |
stachyose biosynthesis | 2.4.1.123-RXN | EC-2.4.1.123 | inositol 3-α-galactosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EC955443 | 232 | 17 | 248 | 0 |
CF516187 | 213 | 1 | 213 | 0 |
DT551209 | 248 | 1 | 248 | 0 |
DW482029 | 248 | 1 | 248 | 0 |
DW482030 | 248 | 1 | 248 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |