| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01028243001 |
| Family | GH19 |
| Protein Properties | Length: 174 Molecular Weight: 19174.4 Isoelectric Point: 7.8522 |
| Chromosome | Chromosome/Scaffold: 7 Start: 4889158 End: 4890220 |
| Description | Chitinase family protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH19 | 15 | 167 | 0 |
| VTQEEVSPQSDYCDSTNTEWPCYPGKSYKGRGPIQLSWNYNYGPAGKALGFDGLRNPEIVSNNSVTAFRTALWFWMTEQKPKPSCHNVMVGRYVPTAEDV AANRTAGFGLTTNIINGGLECGIPNDGRVNDRIGYFQRYAALFKVGTGPSLDC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 174 Download |
| MTHSFKQQDA SLHLVTQEEV SPQSDYCDST NTEWPCYPGK SYKGRGPIQL SWNYNYGPAG 60 KALGFDGLRN PEIVSNNSVT AFRTALWFWM TEQKPKPSCH NVMVGRYVPT AEDVAANRTA 120 GFGLTTNIIN GGLECGIPND GRVNDRIGYF QRYAALFKVG TGPSLDCAYQ KSF* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG3179 | COG3179 | 0.0001 | 39 | 91 | 53 | + Predicted chitinase [General function prediction only] | ||
| cd00442 | lysozyme_like | 1.0e-8 | 29 | 98 | 70 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. | ||
| pfam00182 | Glyco_hydro_19 | 6.0e-75 | 18 | 167 | 150 | + Chitinase class I. | ||
| cd00325 | chitinase_glyco_hydro_19 | 7.0e-82 | 18 | 167 | 150 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004568 | chitinase activity |
| GO:0006032 | chitin catabolic process |
| GO:0016998 | cell wall macromolecule catabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACU24402.1 | 0 | 14 | 173 | 113 | 272 | unknown [Glycine max] |
| EMBL | CAA57773.1 | 0 | 14 | 173 | 118 | 277 | chitinase (class II) [Arachis hypogaea] |
| EMBL | CAN83140.1 | 0 | 14 | 173 | 108 | 267 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI37052.1 | 0 | 1 | 173 | 1 | 173 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002515175.1 | 0 | 14 | 173 | 115 | 274 | class I chitinase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4dyg_B | 0 | 17 | 173 | 88 | 243 | A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase (Ec 6.1.1.2) (Tryptophan-Trna Ligase)(Trprs) (Tm0492) From Thermotoga Maritima At 2.50 A Resolution |
| PDB | 4dyg_A | 0 | 17 | 173 | 88 | 243 | A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase (Ec 6.1.1.2) (Tryptophan-Trna Ligase)(Trprs) (Tm0492) From Thermotoga Maritima At 2.50 A Resolution |
| PDB | 4dwx_B | 0 | 17 | 173 | 88 | 243 | A Chain A, Crystal Structure Of A Family Gh-19 Chitinase From Rye Seeds |
| PDB | 4dwx_A | 0 | 17 | 173 | 88 | 243 | A Chain A, Crystal Structure Of A Family Gh-19 Chitinase From Rye Seeds |
| PDB | 3cql_B | 0 | 18 | 173 | 88 | 242 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| chitin degradation II | 3.2.1.14-RXN | EC-3.2.1.14 | chitinase |
| chitin degradation II | RXN-12623 | EC-3.2.1.14 | chitinase |
| chitin degradation II | RXN-12624 | EC-3.2.1.14 | chitinase |
| chitin degradation III (carnivorous plants) | 3.2.1.14-RXN | EC-3.2.1.14 | chitinase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| FS353473 | 161 | 14 | 174 | 0 |
| FS348773 | 161 | 14 | 174 | 0 |
| FS359082 | 161 | 14 | 174 | 0 |
| GO026570 | 161 | 14 | 174 | 0 |
| FS346038 | 161 | 14 | 174 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
