| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01029165001 |
| Family | GH16 |
| Protein Properties | Length: 202 Molecular Weight: 23143.8 Isoelectric Point: 4.9528 |
| Chromosome | Chromosome/Scaffold: 11 Start: 18992835 End: 18994165 |
| Description | xyloglucan endotransglycosylase 6 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH16 | 3 | 133 | 5.7e-23 |
| LKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGV PYLKNQPMRIYSSLWNADDWATRGGLIKTDW | |||
| Full Sequence |
|---|
| Protein Sequence Length: 202 Download |
| MQLKLVPGNS AGTVTAYYLS SQGPTHDEID FEFLGNLSGD PYILHTNVFS QGKGNREQQF 60 YLWFDPTADF HTYSILWNPQ RIIFSVDGTP IREFKNSESI GVPYLKNQPM RIYSSLWNAD 120 DWATRGGLIK TDWTQAPFTA SYRNFNADAC ICTDWYSQEL DSTSQERMKW VQKNYMIYNY 180 CTDTKRFPQG LPPECTATTT S* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam06955 | XET_C | 4.0e-22 | 155 | 195 | 44 | + Xyloglucan endo-transglycosylase (XET) C-terminus. This family represents the C-terminus (approximately 60 residues) of plant xyloglucan endo-transglycosylase (XET). Xyloglucan is the predominant hemicellulose in the cell walls of most dicotyledons. With cellulose, it forms a network that strengthens the cell wall. XET catalyzes the splitting of xyloglucan chains and the linking of the newly generated reducing end to the non-reducing end of another xyloglucan chain, thereby loosening the cell wall. Note that all family members contain the pfam00722 domain. | ||
| cd02183 | GH16_fungal_CRH1_transglycosylase | 8.0e-25 | 9 | 147 | 151 | + glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
| pfam00722 | Glyco_hydro_16 | 7.0e-62 | 1 | 134 | 136 | + Glycosyl hydrolases family 16. | ||
| PLN03161 | PLN03161 | 3.0e-98 | 1 | 195 | 214 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
| cd02176 | GH16_XET | 3.0e-130 | 1 | 195 | 212 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005618 | cell wall |
| GO:0005975 | carbohydrate metabolic process |
| GO:0006073 | cellular glucan metabolic process |
| GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN80250.1 | 0 | 1 | 201 | 69 | 287 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI17802.1 | 0 | 1 | 201 | 1 | 200 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI17804.1 | 0 | 1 | 201 | 1 | 201 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002270416.1 | 0 | 1 | 201 | 78 | 296 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002274601.1 | 0 | 1 | 201 | 79 | 297 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1un1_B | 0 | 1 | 195 | 64 | 272 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 1un1_A | 0 | 1 | 195 | 64 | 272 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 1umz_B | 0 | 1 | 195 | 64 | 272 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 1umz_A | 0 | 1 | 195 | 64 | 272 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 2uwb_B | 0 | 3 | 195 | 67 | 267 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EC969477 | 220 | 1 | 202 | 0 |
| EC951261 | 220 | 1 | 202 | 0 |
| EC970721 | 220 | 1 | 202 | 0 |
| EC959373 | 220 | 1 | 202 | 0 |
| EC964102 | 220 | 1 | 202 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
